triangle PDBeMotif: 4kbp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.1.3.2
Classification hydrolase (phosphoric monoester)    | release date: Mon, Oct 2, 1995
Title kidney bean purple acid phosphatase
Authors B.KREBS, N.STRATER, T.KLABUNDE
Method X-RAY DIFFRACTION (resolution: 2.70Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search ZN ZN binding statistics ZN   search FE FE binding statistics FE   search PO4 PO4 binding statistics PO4
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
FVRKTNKNRDMPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSSAVRYWSEKNGRKRIAKGKMSTYRFF
NYSSGFIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQTGLDVPYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVL
FVGDLSYADRYPNHDNVRWDTWGRFTERSVAYQPWIWTAGNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSI
KRASAHIIVLSSYSAYGRGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEGEAMRTKFEAWFVKYKVDVVF
AGHVHAYERSERVSNIAYKITDGLCTPVKDQSAPVYITIGDAGNYGVIDSNMIQPQPEYSAFREASFGHGMFDIKNRTHA
HFSWNRNQDGVAVEADSVWFFNRHWYPVDDST
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PURPLE ACID PHOSPHATASE
member of: CATH:search2.60.40.380/search3.60.21.10GENE3D:searchG3DSA_2.60.40.380/searchG3DSA_3.60.21.10PANTHER:searchPTHR22953/searchPTHR22953_SF0PFAM:searchPF00149/searchPF14008SUPERFAMILY:searchSSF49363/searchSSF56300UniProt:searchP80366
JMol viewer RasMol script viewer  PO4 440A  ..                                                                                                                                                           *  *                                 **                                                                                             *                          * *                                                                                                           
JMol viewer RasMol script viewer  ZN 439A  ..                                                                                                                                                           *  |                                 *|                                                                                   *         |                          * |                                                                                                           
JMol viewer RasMol script viewer  FE 438A  ..                                                                                                                              *                            *  *                                 ||                                                                                   |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *  *                                 
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *  |                                 
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *  |                                 
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                                 
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                                 
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                                 
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                   *             
JMol viewer RasMol script viewer  NAG 437A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||     ** *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436A  ..                                                                                                                              |                            |  |                                 ||     *| |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..                                                                                                                              |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..                                                                                                                              |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..       *                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..  *    *                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..  |    |                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..  |    *                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..  |    |                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..  |    *                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..  |    |                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435A  ..  |    |                                                                                                                      |       |   *                |  |                    *            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       *                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       *                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       |                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       *                                                                                    |                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       |                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       |                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       |                                                                                   **                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       |                                                                                   |*                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       |                                                                                   ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       |                                                                                   ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       |                                                                                   ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       |                                                                                   ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434A  ..  |    |       |                                                                                   *|                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433A  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
sec str:  .........hhh............eeee.......eeeeeee.......eeeeee......eeee.eee..........eeeeeee.......eeeeee......eeeeee..........eeeeee......hhhhhhhhhhhh......eeee......hhh.hhh.hhhhhhhhhhhhhhh..........hhhh...hhh......hhhhhh....hhh........eeeee..eeeee...........hhhhhhhhhhhh.......eeeee..............hhhhhhhhhhhhhhh....eeee.....eeee........................eeeee....................eeeee...eeeeeee....eeeeeeee.......eeeeeeee...........
sequence :  ..RDMPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSSAVRYWSEKNGRKRIAKGKMSTYRFFNYSSGFIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQTGLDVPYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSVAYQPWIWTAGNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSYSAYGRGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEGEAMRTKFEAWFVKYKVDVVFAGHVHAYERSERVSNIAYKITDGLCTPVKDQSAPVYITIGDAGNYGVIDSNMIQPQPEYSAFREASFGHGMFDIKNRTHAHFSWNRNQDGVAVEADSVWFFNRHWYPVDDST
seq num:  ..9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  || ||       |  |  |  | | |       |  |  | |    | || ||        | | |^***      | |            | |^*** ||      || ||        | | | ||^***| || | |         | |||| ||  ||| ||||   | |||  |       || ||| | |^*** ||  | ||  || || | | || | | |||         | |  |        || |||   | |          | ||| || |  | ||||  || |||      || |   | |   | || || |     | ||    |  | | ||| | |     |  |||             ^***      |  ||  | ||     | | | |||| 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |  || ||       |  |  |  | | |       |  |  | |    | || ||        | | | |        | |            | | ||**^*      || ||        | | | ||| | | || | |         | |||| ||  ||| ||||   | |||  |       || ||| | ||| | ||  | ||  || || | | || | **^*|         | |  |        || |||   | |          | ||| || |  | ||||  || |||      || |   | |   | || || |     | ||    |  | | ||| | |     |  |||             |  |      |  ||  | ||     | | | |||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || ||       |  |  |  | | |       |  |  | |    ^**| ||        ^** | |        ^**            | | ^**         || ||        | | | ||| | | || ^**         | |||| ||  ||| ||||   ^**||  |       || ||| | ||| | ||  ^**|  || || | | || ^** | |         | |  |        || |||   | |          | ||| || |  | ||||  || |||      || |   ^**   | || || |     | ||    |  | | ||| | |     |  |||             |  |      |  ||  | ||     | | | |||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || ||       |  |  ^*** | |       ^***  | |       | ||            | |                       | |  |          ^***|        | | | ||| | ^*** | |         | ^*** ||  ||| ||||   |  ||  |       || ||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  | ^***  || |||      || |         | || || |     | ||    ^*** | ||| | |     |  |||             |  |      |  ||  | ||     | | | |||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  || ||       |  |       | |       |  |  | |       | ||            | |                       ^*****           |  |        | | | ||| | | |  | |         | |||| ||  ||| ||||   |  ||  |       || ||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  |  ||   || |||      || |         | || || |     | ||         | |^*****     |  |||             |  |      |  ||  | ||     | | | |||| 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  || ||       |  |       | |       |  |  | |       ^***            | |                       | |  |           |  |        | | | ||| | | |  | |         | |||| ||  ||| ||||   |  ||  |       || ||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  |  ||   || |||      || |         | || || |     | ||         | ||| | |     |  |||             |  |      |  ||  | ||     | | | |||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  || ||       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | ***** | | |  | |         | |||| ||  |******|   |  ||  |       || ||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  *****   || |||      || |         | || || |     | ||         | ||| | |     |  |||             |  |      |  ||  | ||     | | | |||| 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  || ||       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | | ||| | | |  | |         | |||| ||  ||| || |   |  ||  |       || ||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  |  |    || |||      || |         | || || |     | ||         | ||| | |     |  |||             |  |      |  ||  | ||     ***** |||| 
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  || ||       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | | ||| | | |  | |         | |||| ||  ||| || |   |  ||  |       || ||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  |  |    || |||      || |         | || || |     ***|         | ||| | |     |  |||             |  |      |  ||  | ||     *** | |||| 
search RasMol script viewer Motif-ligand binding stats  betabulge ..   |  || ||       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | | ||| | | |  | |         | |||| ||  ||| || |   |  ||  |       || ||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  |  |    || |||      || |         | || || |     |  |         | ||| | |     |  |**             |  |      |  ||  | **         | |||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   *******|       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | ****| | | |  | |         | ||************* |   ****|  |       || ||| ****| ****  |  |  ****| | | ||     | |         | |  |        ****||   | |          | ||| || |  ****    |****|      || |         | || || |     |  |         ****| | |     |  |               |  |      |  ||  |            | |||| 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  ||  |       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | | | | | | |  | |         | |||| |          |   |   |  |       || |||   | | | |   |  |   |  | | | ||     | |         | |  |         |  ||   | |          | ||| || |          |  | |      |***         | |***| |     |  |           | | | |     |  |               |  |      |  ||  |            *****| 
search RasMol script viewer Motif-ligand binding stats  nest ..   |  ||  |       |  |       ***       |  |  | |       | |             | |                       ***  |           |  |        *** | | | | | |  | |         ****** |          |   |   |  |       || ***   *** | |   |  |   |  | | | ||     | |         | |  |         |  ||   | |          | ||| |***          |  ***      |            | |   ***     |  |           *** | |     |  |               |  |      |  ||  |               | | 
search RasMol script viewer Motif-ligand binding stats  niche ..   ********       ****                 ****  ***       ***             ***                       |    |           ****            | | | | | ******           ||****          |   |   ****       ||  |      *** |   ****   **** | ****     ***         ******         ****|   ***          *******             |    |      |            ***           ****               ***     ****               ****      ********               *** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                             | |                                                 |    |                           | | | | |                  |||             |   |              ||  |          |   |           | | |                                     |   |                                ******      |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                             | |                                                 |    |                           ***** | |                  |||             |   |              ||  |          |   |           | | |                                     |   |                                            |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                             | |                                                 ******                             *******                  |||             *****              ||  |          *****           | | |                                     *****                                            |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                             ***                                                                                                             ***                                ||  |                          *****                                                                                      |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                              *                                 **  *                                                                                                                     *                                                                                                             

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : PURPLE ACID PHOSPHATASE
member of: CATH:search2.60.40.380/search3.60.21.10GENE3D:searchG3DSA_2.60.40.380/searchG3DSA_3.60.21.10PANTHER:searchPTHR22953/searchPTHR22953_SF0PFAM:searchPF00149/searchPF14008SUPERFAMILY:searchSSF49363/searchSSF56300UniProt:searchP80366
JMol viewer RasMol script viewer  PO4 440B  ..                                                                                                                                                           *  *                                 **                                                                                            **                          * *                                                                                                           
JMol viewer RasMol script viewer  ZN 439B  ..                                                                                                                                                           *  |                                 *|                                                                                   *        ||                          * |                                                                                                           
JMol viewer RasMol script viewer  FE 438B  ..                                                                                                                              *                            *  *                                 ||                                                                                   |        ||                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      *  *                                 
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      *  |                                 
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      *  |                                 
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      |  |                                 
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      |  |                                 
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      |  |                                 
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      |  |                   *             
JMol viewer RasMol script viewer  NAG 437B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||                                                                                   |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||     ** *                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436B  ..                                                                                                                              |                            |  |                                 ||     *| |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..                                                                                                                              |       *                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..                                                                                                                              |       *                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..       *                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..  *    *                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..  |    |                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..  |    *                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..  |    |                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..  |    *                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..  |    |                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435B  ..  |    |                                                                                                                      |       |   *                |  |                    *            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       *                                                                                                              |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       *                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       |                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       *                                                                                    |                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       |                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       |                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       |                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       |                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       |                                                                                    |                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       |                                                                                    |                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       |                                                                                    |                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       |                                                                                    |                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434B  ..  |    |       |                                                                                   *|                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433B  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |        ||                          | |                                                                      |  |                   |             
sec str:  .........hhh............eeee.......eeeeeee.......eeeeee......eeee.eee..........eeeeeee.......eeeeee......eeeeee..........eeeeee......hhhhhhhhhhhh.......eee......hhh.hhh.hhhhhhhhhhhhhhh..........hhhh...hhh......hhhhhh...............eeeee..eeeee...........hhhhhhhhhhhh.......eeeee..............hhhhhhhhhhhhhhh....eeee.....eeee........................eeeee....................eeeee...eeeeeee....eeeeeeee.......eeeeeeee...........
sequence :  ..RDMPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSSAVRYWSEKNGRKRIAKGKMSTYRFFNYSSGFIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQTGLDVPYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSVAYQPWIWTAGNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSYSAYGRGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEGEAMRTKFEAWFVKYKVDVVFAGHVHAYERSERVSNIAYKITDGLCTPVKDQSAPVYITIGDAGNYGVIDSNMIQPQPEYSAFREASFGHGMFDIKNRTHAHFSWNRNQDGVAVEADSVWFFNRHWYPVDDST
seq num:  ..9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  || ||       |  |  |  | | |       |  |  | |    | || ||        | | |^***      ||| |          | |^*** ||      || ||        | | ||| ^***|||| | |         | |||| ||  ||||||||   | | |  |       || ||| | |^*** ||  | ||  || || | | || | | |||           |  |        || |||   | |          | ||| || |  | ||||  || |||      || |   | |   | || || |     | ||    |  | | ||| | |     |  |||             ^***      |  ||  |        | | | |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |  || ||       |  |  |  | | |       |  |  | |    | || ||        | | | |        ||| |          | | ||**^*      || ||        | | ||| ||| |||| | |         | |||| ||  ||||||||   | | |  |       || ||| | ||| | ||  | ||  || || | | || | **^*|           |  |        || |||   | |          | ||| || |  | ||||  || |||      || |   | |   | || || |     | ||    |  | | ||| | |     |  |||             |  |      |  ||  |        | | | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || ||       |  |  |  | | |       |  |  | |    ^**| ||        ^** | |        ^** |          | | ^**         || ||        | | ||| ||| |||| ^**         | |||| ||  ||||||||   ^** |  |       || ||| | ||| | ||  ^**|  || || | | || ^** | |           |  |        || |||   | |          | ||| || |  | ||||  || |||      || |   ^**   | || || |     | ||    |  | | ||| | |     |  |||             |  |      |  ||  |        | | | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || ||       |  |  ^*** | |       ^***  | |       | ||            | |         |  |          | |  |          ^***|        | | ||| ||| ^*** | |         | ^*** ||  ||||||||   |   |  |       || ||| | ||| | ||  |  |  || || | | ||     | |           |  |        || |||   | |          | ||| || |  | ^***  || |||      || |         | || || |     | ||    ^*** | ||| | |     |  |||             |  |      |  ||  |        | | | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  || ||       |  |       | |       |  |  | |       | ||            | |         |  |          ^*****           |  |        | | ||| ||| |||  | |         | |||| ||  ||||||||   |   |  |       || ||| | ||| | ||  |  |  || || | | ||     | |           |  |        || |||   | |          | ||| || |  |  ||   || |||      || |         | || || |     | ||         | |^*****     |  |||             |  |      |  ||  |        | | | |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  || ||       |  |       | |       |  |  | |       ^***            | |         |  |          | |  |           |  |        | | ||| ||| |||  | |         | |||| ||  ||||||||   |   |  |       || ||| | ||| | ||  |  |  || || | | ||     | |           |  |        || |||   | |          | ||| || |  |  ||   || |||      || |         | || || |     | ||         | ||| | |     |  |||             |  |      |  ||  |        | | | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  || ||       |  |       | |       |  |  | |       | |             | |         |  |          | |  |           |  |        | | |*********|  | |         | |||| ||  |******|   |   |  |       || ||| | ||| | ||  |  |  || || | | ||     | |           |  |        || |||   | |          | ||| || |  *****   || |||      || |         | || || |     | ||         | ||| | |     |  |||             |  |      |  ||  |        | | | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  || ||       |  |       | |       |  |  | |       | |             | |         |  |          | |  |           |  |        | | ||| ||| | |  | |         | |||| ||  |||||| |   |   |  |       || ||| | ||| | ||  |  |  || || | | ||     | |           |  |        || |||   | |          | ||| || |  |  |    || |||      || |         | || || |     ***|         | ||| | |     |  |||             |  |      |  ||  |        *** | |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..   |  || ||       |  |       | |       |  |  | |       | |             | |         |  |          | |  |           |  |        | | ||| ||| | |  | |         | |||| ||  |||||| |   |   |  |       || ||| | ||| | ||  |  |  || || | | ||     | |           |  |        || |||   | |          | ||| || |  |  |    || |||      || |         | || || |     |  |         | ||| | |     |  |**             |  |      |  ||  |            | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   *******|       |  |       | |       |  |  | |       | |             | |         |  |          | |  |           |  |        | | |******** |  | |         | ||************* |   |   |  |       || ||| ****| ****  |  |  ****| | | ||     | |           |  |        ****||   | |          | ||| || |  ****    |****|      || |         | || || |     |  |         ****| | |     |  |               |  |      |  ||  |            | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  ||  |       |  |       | |       |  |  | |       | |             | |         |  |          | |  |           |  |        | | | | | | | |  | |         | |||| |          |   |   |  |       || |||   | |   |   |  |   |  | | | ||     | |           |  |         |  ||   | |          | ||| || |          |  | |      |***         | |***| |     |  |           | | | |     |  |               |  |      |  ||  |            | |    
search RasMol script viewer Motif-ligand binding stats  nest ..   |  ||  |       |  |       ***       |  |  | |       | |             | |         |  |          ***  |           |  |        *** | | | | | |  | |         ****** |          |   |   |  |       || ***   ***   |   |  |   |  | | | ||     | |           |  |         |  ||   | |          | ||| |***          |  ***      |            | |   ***     |  |           *** | |     |  |               |  |      |  ||  |            | |    
search RasMol script viewer Motif-ligand binding stats  niche ..   ********       ****                 ****  ***       ***             ***         ****          |    |           ****            | | | | | ******           ||****          |   |   ****       ||  |          |   ****   **** | ****     ***           ****         ****|   ***          *******             |    |      |            ***           ****               ***     ****               ****      ********            ***    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                             | |                                                 |    |                           | | | | |                  |||             |   |              ||  |          |   |           | | |                                     |   |                                ******      |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                             | |                                                 |    |                           ***** | |                  |||             |   |              ||  |          |   |           | | |                                     |   |                                            |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                             | |                                                 ******                             *******                  |||             *****              ||  |          *****           | | |                                     *****                                            |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                             ***                                                                                                             ***                                ||  |                          *****                                                                                      |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                              *                                 **  *                                                                                                                     *                                                                                                             

chain C : PURPLE ACID PHOSPHATASE
member of: CATH:search2.60.40.380/search3.60.21.10GENE3D:searchG3DSA_2.60.40.380/searchG3DSA_3.60.21.10PANTHER:searchPTHR22953/searchPTHR22953_SF0PFAM:searchPF00149/searchPF14008SUPERFAMILY:searchSSF49363/searchSSF56300UniProt:searchP80366
JMol viewer RasMol script viewer  PO4 440C  ..                                                                                                                                                           *  *                                 **                                                                                             *                          * *                                                                                                           
JMol viewer RasMol script viewer  ZN 439C  ..                                                                                                                                                           *  |                                 *|                                                                                   *         |                          * |                                                                                                           
JMol viewer RasMol script viewer  FE 438C  ..                                                                                                                              *                            |  *                                 ||                                                                                   |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *                                    
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *  *                                 
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *  |                                 
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      *  |                                 
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                                 
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                                 
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                                 
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                   *             
JMol viewer RasMol script viewer  NAG 437C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||     ** *                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 436C  ..                                                                                                                              |                            |  |                                 ||     *| |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..                                                                                                                              |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..                                                                                                                              |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..       *                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..  *    |                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..  |    |                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..  |    |                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..  |    *                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..  |    |                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..  |    *                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..  |    |                                                                                                                      |       |                    |  |                                 ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 435C  ..  |    |                                                                                                                      |       |   *                |  |                    *            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       *                                                                                                              |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       *                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       |                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       *                                                                                    |                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       |                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       |                                                                                    *                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       |                                                                                   **                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       |                                                                                   |*                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       |                                                                                   ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       |                                                                                   ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       |                                                                                   ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       |                                                                                   ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 434C  ..  |    |       |                                                                                   *|                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        *                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
JMol viewer RasMol script viewer  NAG 433C  ..  |    |       |                                                        |                          ||                         |       |   |                |  |                    |            ||     || |                                                                          |         |                          | |                                                                      |  |                   |             
sec str:  .........hhh............eeee.......eeeeeee.......eeeeee......eeee.eee..........eeeeeee.......eeeeee......eeeeee..........eeeeee......hhhhhhhhhhhh......eeee......hhh.hhh.hhhhhhhhhhhhhhh..........hhhh...hhh......hhhhhh...............eeeee..eeeee...........hhhhhhhhhhhh.......eeeee..............hhhhhhhhhhhhhhh....eeee.....eeee........................eeeee....................eeeee...eeeeeee....eeeeeeee.......eeeeeeee...........
sequence :  ..RDMPLDSDVFRVPPGYNAPQQVHITQGDLVGRAMIISWVTMDEPGSSAVRYWSEKNGRKRIAKGKMSTYRFFNYSSGFIHHTTIRKLKYNTKYYYEVGLRNTTRRFSFITPPQTGLDVPYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSVAYQPWIWTAGNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSYSAYGRGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEGEAMRTKFEAWFVKYKVDVVFAGHVHAYERSERVSNIAYKITDGLCTPVKDQSAPVYITIGDAGNYGVIDSNMIQPQPEYSAFREASFGHGMFDIKNRTHAHFSWNRNQDGVAVEADSVWFFNRHWYPVDDST
seq num:  ..9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  || ||       |  |  |  | | |       |  |  | |    | || ||        | | |^***      | |            | |^*** ||      || ||        | | | | ^***| || | |         | |||| |    || ||||   | | |  |      ||||||| | |^*** ||  | ||  || || | | || | | |||         | |  |        || |||   | |          | ||| || |  | ||||  || |||      || |   | |   | || || |     | ||    |  | | ||| | |     |  |||             ^***      |  ||  | ||     | | | | | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |  || ||       |  |  |  | | |       |  |  | |    | || ||        | | | |        | |            | | ||**^*      || ||        | | | | | | | || | |         | |||| |    || ||||   | | |  |      ||||||| | ||| | ||  | ||  || || | | || | **^*|         | |  |        || |||   | |          | ||| || |  | ||||  || |||      || |   | |   | || || |     | ||    |  | | ||| | |     |  |||             |  |      |  ||  | ||     | | | | | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || ||       |  |  |  | | |       |  |  | |    ^**| ||        ^** | |        ^**            | | ^**         || ||        | | | | | | | || ^**         | |||| |    || ||||   ^** |  |      ||||||| | ||| | ||  ^**|  || || | | || ^** | |         | |  |        || |||   | |          | ||| || |  | ||||  || |||      || |   ^**   | || || |     | ||    |  | | ||| | |     |  |||             |  |      |  ||  | ||     | | | | | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || ||       |  |  ^*** | |       ^***  | |       | ||            | |                       | |  |          ^***|        | | | | | | ^*** | |         | ^*** |    || ||||   |   |  |      ||||||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  | ^***  || |||      || |         | || || |     | ||    ^*** | ||| | |     |  |||             |  |      |  ||  | ||     | | | | | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  || ||       |  |       | |       |  |  | |       | ||            | |                       ^*****           |  |        | | | | | | | |  | |         | |||| |    || ||||   |   |  |      ||||||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  |  ||   || |||      || |         | || || |     | ||         | |^*****     |  |||             |  |      |  ||  | ||     | | | | | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  || ||       |  |       | |       |  |  | |       ^***            | |                       | |  |           |  |        | | | | | | | |  | |         | |||| |    || ||||   |   |  |      ||||||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  |  ||   || |||      || |         | || || |     | ||         | ||| | |     |  |||             |  |      |  ||  | ||     | | | | | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  || ||       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | | | | | | |  | |         | |||| |    ******|   |   |  |      ||||||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  *****   || |||      || |         | || || |     | ||         | ||| | |     |  |||             |  |      |  ||  | ||     | | | | | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  || ||       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | | | | | | |  | |         | |||| |    || || |   |   |  |      ||||||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  |  |    || |||      || |         | || || |     | ||         | ||| | |     |  |||             |  |      |  ||  | ||     ***** | | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  || ||       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | | | | | | |  | |         | |||| |    || || |   |   |  |      ||||||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  |  |    || |||      || |         | || || |     ***|         | ||| | |     |  |||             |  |      |  ||  | ||     *** | | | |
search RasMol script viewer Motif-ligand binding stats  betabulge ..   |  || ||       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | | | | | | |  | |         | |||| |    || || |   |   |  |      ||||||| | ||| | ||  |  |  || || | | ||     | |         | |  |        || |||   | |          | ||| || |  |  |    || |||      || |         | || || |     |  |         | ||| | |     |  |**             |  |      |  ||  | **         | | | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..   *******|       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | | | | | | **** |         | |||| |    ***** |   |   |  |      ****||| ****| ****  |  |  ****| | | ||     | |         | |  |        ****||   | |          | ||| || |  ****    |****|      || |         | || || |     |  |         ****| | |     |  |               |  |      |  ||  |            | | | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   |  ||  |       |  |       | |       |  |  | |       | |             | |                       | |  |           |  |        | | | | | | | |  | |         | |||| |          |   |   |  |       || |||   | | | |   |  |   |  | | | ||     | |         | |  |         |  ||   | |          | ||| || |          |  | |      |***         | |***| |     |  |           | | | |     |  |               |  |      |  ||  |            *** ***
search RasMol script viewer Motif-ligand binding stats  nest ..   |  ||  |       |  |       ***       |  |  | |       | |             | |                       ***  |           |  |        *** | | | | | |  | |         ****** |          |   |   |  |       || ***   *** | |   |  |   |  | | | ||     | |         | |  |         |  ||   | |          | ||| |***          |  ***      |            | |   ***     |  |           *** | |     |  |               |  |      |  ||  |                   
search RasMol script viewer Motif-ligand binding stats  niche ..   ********       ****                 ****  ***       ***             ***                       |    |           ****            | | | | | ******           ||****          |   |   ****       ||  |      *** |   ****   **** | ****     ***         ******         ****|   ***          *******             |    |      |            ***           ****               ***     ****               ****      ********                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                             | |                                                 |    |                           | | | | |                  |||             |   |              ||  |          |   |           | | |                                     |   |                                ******      |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                             | |                                                 ******                           | *******                  |||             *****              ||  |          *****           | | |                                     *****                                            |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                             ***                                                                                  ***                        ***                                ||  |                          *****                                                                                      |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                              *                                 **  *                                                                                                                     *                                                                                                             

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : PURPLE ACID PHOSPHATASE
member of: CATH:search2.60.40.380/search3.60.21.10GENE3D:searchG3DSA_2.60.40.380/searchG3DSA_3.60.21.10PANTHER:searchPTHR22953/searchPTHR22953_SF0PFAM:searchPF00149/searchPF14008SUPERFAMILY:searchSSF49363/searchSSF56300UniProt:searchP80366
JMol viewer RasMol script viewer  PO4 440D  ..                                                                                                                                                           *  *                                 **                                                                                             *                          * *                                                                                                           
JMol viewer RasMol script viewer  ZN 439D  ..                                                                                                                                                           *  |                                 *|                                                                                   *         |                          * |                                                                                                           
JMol viewer RasMol script viewer  FE 438D  ..                                                                                                                              *                            |  *                                 ||                                                                                   |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||                                                                                   |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||        *                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||        |                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||     ** *                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 436D  ..                                                                                                                              |                            |  |                                 ||     *| |                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 435D  ..                                                                                                                              |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 435D  ..                                                                                                                              |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                                                                           
JMol viewer RasMol script viewer  NAG 435D  ..       *                                                                                                                      |       *                    |  |                                 ||     || |                                                                          |         |                          | |                                                         &n