triangle PDBeMotif: 4k93  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transferase    | release date: Fri, Apr 19, 2013
Title crystal structure of probable sugar kinase protein from rhiz cfn 42 complexed with n-(hydroxymethyl)benzamide
Authors A.CELIKGIL, A.FISER, A.GIZZI, A.KAR, B.EVANS, B.HILLERICH, B.MATIKAINEN, CONSORTIUM (NYSGRC), G.VILLEGAS, H.PATEL, J.B.BONANNO, J.LAFLUER, J.LOVE, K.KHAFIZOV, M.K.CHAN, NEW YORK STRUCTURAL GENOMICS RESEARCH, R.BHOSLE, R.S, R.TORO, S.C.ALMO, S.CHAMALA, S.GARFO, S.L, V.N.MALASHKEVICH
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Small molecules:    search DMS DMS binding statistics DMS   search ADN ADN binding statistics ADN   search 1Q8 1Q8 binding statistics 1Q8   search K K binding statistics K
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MHHHHHHSSGVDLGTENLYFQSMTRFDVLTVGNAIVDIISRCNDQFLIDNQITKAAMNLIDAERAELLYSRMGPALEASG
GSAGNTAAGVANLGGKAAYFGNVAADQLGDIFTHDIRAQGVHYQTKPKGAFPPTARSMIFVTEDGERSMNTYLGACVELG
PEDVEADVVADAKVTYFEGYLWDPPRAKEAILDCARIAHQHGREMSMTLSDSFCVDRYRGEFLDLMRSGKVDIVFANRQE
ALSLYQTDDFEEALNRIAADCKIAAVTMSENGAVILKGRERYYVNAIRIREVVDTTGAGDLFASGFLYGYTQGRSLEDCG
KLGCLAAGIVIQQIGPRPMTSLSEAAKQAGLI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SUGAR KINASE
member of: GENE3D:searchG3DSA_3.40.1190.20PANTHER:searchPTHR10584/searchPTHR10584_SF3PFAM:searchPF00294PROSITE PATTERNS:searchPS00584, SUPERFAMILY:searchSSF53613UniProt:searchQ2KDX6
JMol viewer RasMol script viewer  1Q8 401B  ..                                              *                                                                  *                                                                                                                                                                                                                        
JMol viewer RasMol script viewer  K 408A  ..                                              |                                                                  |                                                                                                                                                             * *                                 *  * *                 
JMol viewer RasMol script viewer  1Q8 407A  ..                                              |                                     *  **                        |                                                                                                                                                             | |                                 |  | |                 
JMol viewer RasMol script viewer  1Q8 406A  ..                                    ***       |                                     |  ||                        |                *                             *                                                                                                              | |                                 |  | |                 
JMol viewer RasMol script viewer  1Q8 405A  ..                                    |||       |                                     |  ||                        |                |                             |                                   *                        * *         *                                     | |                                 |  | |                 
JMol viewer RasMol script viewer  DMS 404A  ..                                    |||*  *   |                                     |  ||                     *  *               *|                             |                                   |                        | |         |                                     | |                                 |  | |                 
JMol viewer RasMol script viewer  DMS 403A  ..               *                    ||||  **  *                                     |  ||                     |  *               ||                             |                                   |                        | |         |                                     | |                                 |  | |                 
JMol viewer RasMol script viewer  1Q8 402A  ..               |                    ||||  ||  |                                     |  ||                     |  |               ||                             |                            **  *  |                      **| |**       |                                     | |                                 |  | |                 
JMol viewer RasMol script viewer  ADN 401A  ..          * * *|                  * ||||  ||  |          ***  *                     |  ||                     |  |* *         * *||                        * *  |                            ||  |  |                      ||| |||       |                                     | **  *                             |  | |*                
sec str:  .....eeeeee...eeeeeee.hhhhhhhh......eee.hhhhhhhhhhhh...eeee.hhhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhh..ee...........eeeeeee.....eeeeeehhhhhhhhhhhhhhhhhhheeeeeee.hhhh..hhhhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhhhh....eeeeehhhhhhhhh..hhhhhhhhhhhhh.eeeee.hhh.eeeee..eeeee............hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.........hhhhhhhhh...
sequence :  ..MTRFDVLTVGNAIVDIISRCNDQFLIDNQITKAAMNLIDAERAELLYSRMGPALEASGGSAGNTAAGVANLGGKAAYFGNVAADQLGDIFTHDIRAQGVHYQTKPKGAFPPTARSMIFVTEDGERSMNTYLGACVELGPEDVEADVVADAKVTYFEGYLWDPPRAKEAILDCARIAHQHGREMSMTLSDSFCVDRYRGEFLDLMRSGKVDIVFANRQEALSLYQTDDFEEALNRIAADCKIAAVTMSENGAVILKGRERYYVNAIRIREVVDTTGAGDLFASGFLYGYTQGRSLEDCGKLGCLAAGIVIQQIGPRPMTSLSEAAKQAGLI
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |                      | ||  |    |   |   |  |       | |  ||      |||   | |    |         || |||            ^**     | ||||     |  |  | |  |    |  |  |  |  |                   | |    | ||   |        |   ^**|     |   |   | | | | |   || ||     || ||     || |  |          |||||||      |   || ||  ||   |    | |  |    | ||  | || ||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***                      | ||  |    |   |   |  |       | |  ||      |||   | |    |         || |||                    | ||||     |  |  | |  |    |  |  ^***  |                   | |    ^***   |        |   ||||     |   |   | | | | |   || ||     ^***|     || |  |          |||||||      |   || |^***|   |    | |  |    | |^*** || ||||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                           | ||  |    |   |   |  |       | |  ||      |||   | |    |         || |||                    | ||||     |  |  | |  |    |  |     |  |                   | |    | ||   |        |   ||||     |   |   | | | | |   || ||      |  |     ******^          |||||||      |   || ||   |   |    | |  |    | |     || ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                           | ||  |    |   |   |  |       ^*****|      |^***** ^*****         || |||                    | ||||     |  |  | |  |    |  |     |  |                   | |    | ||   |        |   ||||     |   |   | | | | |   || ||      |  |      | |             |||||||      |   || ||   |   ^***** |  |    | |     || ||||
search RasMol script viewer Motif-ligand binding stats  PFKB_KINASES_2 ..                           | ||  |    |   |   |  |         |   |      | |                    || |||                    | ||||     |  |  | |  |    |  |     |  |                   | |    | ||   |        |   ||||     |   |   | | | | |   || ||      |  |      | |             **************   || ||   |          |  |    | |     || ||||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                           | ||  |    *****   |  |         |   |      | |                    || |||                    | ||||     |  |  | |  |    |  |     |  |                   | |    | |*****        |   ||||     *****   | | *****   || ||      |  |      | |             |||||||      |   || ||   |          |  |    | |     || ||||
search RasMol script viewer Motif-ligand binding stats  asxturn ..                           | ||  |            |  |         |   |      | |                    || |||                    | ||||     |  |  | |  |    |  |     |  |                   | |    | |             |   ||||             | | ***     || ||      |  |      | |             ***||||      |   || ||   |          |  |    | |     || ||||
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                           | ||  |            |  |         |   |      | |                    || |||                    *****|     |  |  | |  |    |  |     |  |                   | |    | |             |   ||||             | | |       || ||      |  |      | |             |||||||      |   || ||   |          |  |    | |     || ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..                           | ||  |            ****         |   |      | |                    |****|                    ****||     ****  | |  |    |  |     ****                   | |    | |             |   ||||             | | |       ****|      ****      | |             |****||      |   || ||   |          |  |    | |     |****||
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***|  |            |  |         |   |      ***                    |  ***                      ***|        |  | |  |    |  |                            ***    | |             |   ****             *** |        |  |                | |             | |***|      |   |***|   |          |  |    | |     |  ****
search RasMol script viewer Motif-ligand binding stats  niche ..                              ****            ****         |   |                             |    |                         |        **** ****    ****                                   | |             |   |                  ***        ****                ***             ***||||      |   |   |   |          ****    ***     |    | 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                           |   |                             ******                         |                                                            | |             |   |                  | |                                               ||||      |   |   |   |                          ****** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                           |   |                                                            |                                                            | |             |   |                  | |                                               ||||      |   |   *****                                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                           *****                                                            |                                                            | |             *****                  | |                                               ||||      *****                                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                            |                                                            ***                                    ***                                               ||||                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                            *                                                                                                                                                     ****                                                    

chain B : SUGAR KINASE
member of: GENE3D:searchG3DSA_3.40.1190.20PANTHER:searchPTHR10584/searchPTHR10584_SF3PFAM:searchPF00294PROSITE PATTERNS:searchPS00584, SUPERFAMILY:searchSSF53613UniProt:searchQ2KDX6
JMol viewer RasMol script viewer  K 408B  ..                                                                                                                                                                                                                                                                               * *                                 *  * *                 
JMol viewer RasMol script viewer  1Q8 407B  ..                                    ***                                                                                           *                             *                                                                                                              | |                                 |  | |                 
JMol viewer RasMol script viewer  1Q8 406B  ..                                    |||                                                                                           |                             |                                   *                        ***         *                                     | |                                 |  | |                 
JMol viewer RasMol script viewer  DMS 405B  ..                                    |||*   *                                                                  *  *               *|                             |                                   |                        |||         |                                     | |                                 |  | |                 
JMol viewer RasMol script viewer  DMS 404B  ..               *                    ||||  **  *                                                               |  * *             ||                             |                                   |                        |||         |                                     | |                                 |  | |                 
JMol viewer RasMol script viewer  1Q8 403B  ..               |                    ||||  ||  |                                                               |  | |             ||                             |                            **  *  |                      **|||**       |                                     | |                                 |  | |                 
JMol viewer RasMol script viewer  ADN 402B  ..          * * *|                  * ||||  ||  |          ***  *                                               |  | |          * *||                        * *  |                            ||  |  |                      |||||||       |                                     | **  *                             |  | |*                
JMol viewer RasMol script viewer  1Q8 401B  ..          | | ||                  | ||||  ||  |          |||  |                     *  **                     |  | |          | |||                        | |  |                            ||  |  |                      |||||||       |                                     | ||  |                             |  | ||                
JMol viewer RasMol script viewer  1Q8 407A  ..          | | ||                  | ||||  ||  *          |||  |                     |* ||                     |  * |          | |||                        | |  |                            ||  |  |                      |||||||       |                                     | ||  |                             |  | ||                
sec str:  .....eeeeee...eeeeeee.hhhhhhhh......eee.hhhhhhhhhhhh...eeee.hhhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhh..ee...........eeeeeee.....eeeeeehhhhhhhhhhhhhhhhhhheeeeeee.hhhh..hhhhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhhhh....eeeeehhhhhhhhh..hhhhhhhhhhhhh.eeeee.hhh.eeeee..eeeee............hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.........hhhhhhhhh...
sequence :  ..MTRFDVLTVGNAIVDIISRCNDQFLIDNQITKAAMNLIDAERAELLYSRMGPALEASGGSAGNTAAGVANLGGKAAYFGNVAADQLGDIFTHDIRAQGVHYQTKPKGAFPPTARSMIFVTEDGERSMNTYLGACVELGPEDVEADVVADAKVTYFEGYLWDPPRAKEAILDCARIAHQHGREMSMTLSDSFCVDRYRGEFLDLMRSGKVDIVFANRQEALSLYQTDDFEEALNRIAADCKIAAVTMSENGAVILKGRERYYVNAIRIREVVDTTGAGDLFASGFLYGYTQGRSLEDCGKLGCLAAGIVIQQIGPRPMTSLSEAAKQAGLI
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |                      | ||  |    |   |  || ||       | |  ||    | |||   | |    |   |     || |||            ^**     | ||||     | || || |  |    |  |  |  |  |                   | |    ||||   |        |   ^**|     |   |   | | | | |    |  |     || ||     || |  |          |||||||      |   || ||  ||   |    | |  |    | ||  |    ||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***                      | ||  |    |   |  || ||       | |  ||    | |||   | |    |   |     || |||                    | ||||     | || || |  |    |  |  ^***  |                   | |    ^***   |        |   ||||     |   |   | | | | |    |  |     ^***|     || |  |          |||||||      |   || |^***|   |    | |  |    | |^***    ||||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                           | ||  |    |   |  || ||       | |  ||    | |||   | |    |   |     || |||                    | ||||     | || || |  |    |  |     |  |                   | |    ||||   |        |   ||||     |   |   | | | | |    |  |      |  |     ******^          |||||||      |   || ||   |   |    | |  |    | |        ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                           | ||  |    |   |  || ||       ^*****|    | |^***** ^*****   |     || |||                    | ||||     | || || |  |    |  |     |  |                   | |    ||||   |        |   ||||     |   |   | | | | |    |  |      |  |      | |             |||||||      |   || ||   |   ^***** |  |    | |        ||||
search RasMol script viewer Motif-ligand binding stats  PFKB_KINASES_2 ..                           | ||  |    |   |  || ||         |   |    | |||          |   |     || |||                    | ||||     | || || |  |    |  |     |  |                   | |    ||||   |        |   ||||     |   |   | | | | |    |  |      |  |      | |             **************   || ||   |          |  |    | |        ||||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                           | ||  |    |   |  *****         |   |    | |||          |   |     || |||                    | ||||     | || || |  |    |  |     |  |                   | |    ||||   |        |   ||||     |   |   | | | | |    |  |      |  |      | |             |||||||      |   || ||   |          |  |    | |        ||||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                           | ||  |    *****  || ||         |   |    | |||          *****     || |||                    | ||||     | || || |  |    |  |     |  |                   | |    |||*****        |   ||||     *****   | | *****    |  |      |  |      | |             |||||||      |   || ||   |          |  |    | |        ||||
search RasMol script viewer Motif-ligand binding stats  asxturn ..                           | ||  |           || ||         |   |    | |||                    || |||                    | ||||     | || || |  |    |  |     |  |                   | |    ||||            |   ||||             | | ***      |  |      |  |      | |             |||||||      |   || ||   |          |  |    | |        ||||
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                           | ||  |           || ||         |   |    | |||                    || |||                    *****|     | || || |  |    |  |     |  |                   | |    ||||            |   ||||             | | |        |  |      |  |      | |             |||||||      |   || ||   |          |  |    | |        ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..                           | ||  |           ****|         |   |    ****|                    |****|                    ****||     ******| |  |    |  |     ****                   | |    ||||            |   ||||             | | |        |  |      ****      | |             |****||      |   || ||   |          |  |    | |        ||||
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                           | ||  |            |  |         |   |      | |                    |  | |                      | ||        |  | |  |    |  |                            | |    |***            |   ||||             | | |        |  |                | |             | |||||      |   || ||   |          |  |    | |        ||||
search RasMol script viewer Motif-ligand binding stats  nest ..                           ***|  |            |  |         |   |      ***                    |  ***                      ***|        |  | |  |    |  |                            ***    | |             |   ****             *** |        |  |                | |             | |***|      |   |***|   |          |  |    | |        ****
search RasMol script viewer Motif-ligand binding stats  niche ..                              ****            ****         |   |                             |    |                         |        **** ****    ****                                   | |             |   |                  ***        ****                ***             ***||||      |   |   |   |          ****    ***            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                           |   |                             ******                         |                                                            | |             |   |                  | |                                               ||||      |   |   |   |                                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                           |   |                                                            |                                                            | |             |   |                  | |                                               ||||      |   |   *****                                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                           *****                                                            |                                                            | |             *****                  | |                                               ||||      *****                                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                            |                                                            ***                                    ***                                               ||||                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                            *                                                                                                                                                     ****                                                    

   New search    4k93:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors