triangle PDBeMotif: 4jv8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding/inhibitor    | release date: Mon, Mar 25, 2013
Title the crystal structure of pde6d in complex with rac-s1
Authors A.CHANDRA, A.WITTINGHOFER, B.PAPKE, G.TRIOLA, H.WALDMANN, M.HOFFMANN, N.VARTAK, P.BASTIAENS, S.H, S.ISMAIL, Z.GUNTHER
Method X-RAY DIFFRACTION (resolution: 1.45Å)
PDBe Citation   
Small molecules:    search 1M1 1M1 binding statistics 1M1
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain B sequence:
GSMSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQ
KVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : RETINAL ROD RHODOPSIN-SENSITIVE CGMP 3',5'-CYCLICPHOSPHODIESTERASE SUBUNIT DELTA;
member of: GENE3D:searchG3DSA_2.70.50.40PANTHER:searchPTHR12976PFAM:searchPF05351PIRSF:searchPIRSF037825SUPERFAMILY:searchSSF81296UniProt:searchO43924
JMol viewer RasMol script viewer  1M1 202B  ..                                                   ** *  *                    *       *                    *** ..  *                             * * 
JMol viewer RasMol script viewer  1M1 201B  ..               *  * *         *     *        * *   || |  | *                * |       | *                  *|| ..  |                           * * | 
sec str:  ..hhhhhhhhhhhhheeeeeeeeee.....eeeee.........eeeeeee.hhhhh.eeeeeeeeee...eeeeeeeeeeee..eeeeeeeeeeeee...eeeeeeeeee........hhhhhh..eeeeeeeee..eeeeeeeeeeeee
sequence :  ..SAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAA..SQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV
seq num:  ..2         12        22        32        42        52        62        72        82        92        102        ..115       125       135       145   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |||     |  |  ||    | || | || | || ||  |        || ||       ^*** |   |       ||  |            | ^***   |  |  ..      | |||||        | | ||| |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**||     |  |  ||    | |^** || | || ||  |        || ||         || |   |       ||  |            |  |     |  |  ..      | |||||        | | ||^**      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***|     |  |  ||    | || | || | || ||  |        || ||         ^***   |       ||  |            |  |     ^***  ..      | |||||        | | ||         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| | |     |  |  ||    | || | || | || ||  |        || ||          | |   ********^|  |            |  |           ..      | |||||        | | ||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*** |     |  |  ||    | || | || | || ||  |        || ||          | |            |  |            |  |           ..      | |||||        | | ||         
search RasMol script viewer Motif-ligand binding stats  asxturn ..|   |     |  |  ||    ***| | || | |***|  |        || ||          | |            |  |            |  |           ..      | |||||        | | ||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..|   |     |  |  **       | | ** | ||  |  |        || ||          | |            |  |            |  |           ..      | |||||        | | **         
search RasMol script viewer Motif-ligand binding stats  betaturn ..|   |     ****           | |    | ||  |  |        ****|          | |            ****            |  |           ..      | ****|        | |            
search RasMol script viewer Motif-ligand binding stats  nest ..|   |     |  |           ***    | ||  |  |         |  |          | |                            |  |           ..      |  |***        | |            
search RasMol script viewer Motif-ligand binding stats  niche ..|   |     ****           | |    **********         ****          ***                            ****           ..      *******        ***            
search RasMol script viewer Motif-ligand binding stats  stmotif ..*****                    | |                                                                                   ..                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                         ***                                                                                   ..                                    

   New search    4jv8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors