triangle PDBeMotif: 4jv4  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transferase/transferase inhibitor    | release date: Mon, Mar 25, 2013
Title crystal structure of rialpha(91-379) bound to he33, a n6 di- substituted camp analog
Authors A.S.SALDANHA, B.SANKARAN, C.Y.CHENG, H.COTTAM, J.WU, S.H.J.BROWN, S.S.TAYLOR
Method X-RAY DIFFRACTION (resolution: 2.95Å)
PDBe Citation   
Small molecules:    search 1OR 1OR binding statistics 1OR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
RRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDN
FYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKV
SILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNR
PRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CAMP-DEPENDENT PROTEIN KINASE TYPE I-ALPHA REGULASUBUNIT;
member of: GENE3D:searchG3DSA_2.60.120.10PANTHER:searchPTHR11635/searchPTHR11635_SF129PFAM:searchPF00027PIRSF:searchPIRSF000548PRINTS:searchCAMPKINASEPROSITE PATTERNS:searchPS00888/searchPS00889, PROSITE PROFILES:searchPS50042, SMART:searchSM00100SUPERFAMILY:searchSSF51206UniProt:searchP00514
JMol viewer RasMol script viewer  1OR 402A  ..                                                                                                                                                                              *                      ..1OR ..   *        *****      *** *                                 *  
JMol viewer RasMol script viewer  1OR 401A  ..                                                                                   *        ****      ***                                              * *                    |                      ..1OR ..   |        |||||      ||| |                                 |  
sec str:  ..............hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhheeeee....eee.......eeeeeee..eeeee..eeeeee....ee.hhhhhh......eeee...eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhheeeee..eeeee.........eeeeeeeeeee..... ....eeeee....ee.hhhhhh......eeeeeeeeeeee.hhhhhhhhh..hhhhhhhhhhhh..
sequence :  ..DAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQR... ..FVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNS
seq num:  ..107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297    ... ..310       320       330       340       350       360       370 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| |                   |  | |||  |  || |||  |          ||            |||     |  |   | |||||||||   ||^** |^**|         | |^**      ^**     |  || || || |      | || |          |               |       ..PS00005..       |  | || |  || |       |         |   |        |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..*| |                   |  | ||^***  || |||  |          ||            |||     |  |   ^***||^***|   |||   |   |         | | |               |  || |^*** |      ^*** |          |               |       ..PS00006..       |  | || |  || |       |         |   |        |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |                   |  | |||  |  || |||  |          ||            |||     |  |     | ^*****|   |^*****   |         | | |               |  || |  |  |        |  |          |               |       ..PS00008..       |  | || |  || |       |         |   |        |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_1 .. | |                   |  | |||  |  || |||  |          *****************     |  |     |  | || |   | |       |         | | |               |  || |  |  |        |  |          *****************       ..PS00888..       |  | || |  || |       |         |   |        |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  CNMP_BINDING_2 .. | |                   |  | |||  |  || |||  |          ||            ||      |  |     |  | ******************         | | |               |  || |  |  |        |  |                                  ..PS00889..       |  | ******************         |   |        |  ||  | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |                   |  | |||  |  *****|  |          ||            ||      |  |     |  |  | |   | |                 | | |               |  || |  |  |        |  |                                  ..alphabetamotif..       |  |  | ***** |                 |   |        *****  | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |                   |  *****  ***** | |  |          ||            ||      |  |     |  |  | |   | |                 *****               |  || |  |  |        |  |                                  ..asxmotif..       |  |  | |  || |                 *****        |  |   | |  
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |                   |  ***|      |  | |  |          ||            ||      |  |     |  |  | |   | |                 ***                 |  || |  |  |        |  |                                  ..asxturn..       |  |  | |  || |                              |  |   | |  
search RasMol script viewer Motif-ligand binding stats  betabulge .. | |                   |  |  |      |  | |  |          **            **      |  |     |  |  | |   | |                                     |  || |  |  |        |  |                                  ..betabulge..       |  |  | |  || |                              |  |   | |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |                   *******      **** |  |                                ****     |  |  | |   | |                                     |  || |  |  |        |  |                                  ..betaturn..       ****  | ****| |                              ****   | |  
search RasMol script viewer Motif-ligand binding stats  nest .. | |                   |  |              |  |                                         |  |  ***   ***                                     |  || |  |  |        |  |                                  ..nest..       |  |  ***   ***                                     | |  
search RasMol script viewer Motif-ligand binding stats  niche .. ***                   ****              ****                                         ****                                                |  ****  ****        ****                                  ..niche..       ****                                                ***  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                          *****                                                      ..ststaple..                                                                

   New search    4jv4:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors