triangle PDBeMotif: 4jnl  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.73
Classification hydrolase/hydrolase inhibitor    | release date: Fri, Mar 15, 2013
Title crystal structure of upa in complex with its inhibitor 4- bromobenzylamine at ph 7.4
Authors B.ZHAO, C.YUAN, L.JIANG, M.HUANG, X.ZHANG
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search PZH PZH binding statistics PZH   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain U sequence:
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVEN
LILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVK
LISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPW
IRSHTKE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain U : UROKINASE-TYPE PLASMINOGEN ACTIVATOR
member of: GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24264/searchPTHR24264_SF9PFAM:searchPF00089PRINTS:searchCHYMOTRYPSINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00749
JMol viewer RasMol script viewer  SO4 302U  ..                              *              *                                                                                                                                                    ** *                                                
JMol viewer RasMol script viewer  PZH 301U  ..                              |              |                                                                                                                                                 ***|| |                   *  **      *                 
sec str:  ......ee.hhhhh..eeeeeee.....eeeeeeeeeee..eeeehhhhh....hhh.eeeee............eeeeeeeeee...............eeeeee.............................eeeeee...............eeeeeeeehhhhhh....hhhhh...eeeee...............eeeee....eeeeeeeee..........eeeee...hhhhhhhhh.
sequence :  ..IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
seq num:  ..16        26        36        42        52        60        68        78        88        97        106       112       122       132       142       152       162       170       180       188       198       208       219       228       238   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   |||| |  |      | ||   |       |  | |   ||   | ||  |  |  | |  | |  |          |  |        |||      | |||    | ||      |  |  |  |  |  | |  |  |               ^**|| |  | |  |^**|    | ||||| |||||||  |                 |  |                |   | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   ^*** |  |      | ||   |       |  | |   ||   | ||  |  |  | |  | ^***          |  |        |||      | |||    | ||      |  |  |  ^***  | |  |  |               ^***| |  | |  |||||    | ||||| |||||||  |                 |  |                |   | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |    ||  |  |      | ||   |       |  | |   ||   | *******^  | |  | |  |          |  |        |||      | |||    | ||      |  |  |  |     | |  |  |               |  || |  | |  |||||    | ||||| |||||||  |                 |  |                |   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^*****|  |  |      | ^*****       |  | |   ||   | ||  |  |  | |  | |  |          |  |        |||      | |||    | ||      |  |  |  |     | |  |  |               |  || |  | ^*****||    | ||||| |||||||  |                 |  |                |   | 
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..        |  |  |      |  |           |  | ****^*   | ||  |  |  | |  | |  |          |  |        |||      | |||    | ||      |  |  |  |     | |  |  |               |  || |  | |  || ||    | ||||| |||||||  |                 |  |                |   | 
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..        |  |  |      |  |           |  |     |    | ||  |  |  | |  | |  |          |  |        |||      | |||    | ||      |  |  |  |     | |  |  |               |  || |  | |  || ||    | ||||******^*****                 |  |                |   | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        |  |  |      |  |           |  |     |    | ||  |  |  | |  | |  |          |  |        |||      *****    | ||      |  |  |  |     | |  |  |               |  || |  | |  || ||    | ||||  |||||||                    |  |                |   | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****  |      ****           |  |     |    | ||  |  |  | |  | |  |          |  |        |||      ****|    | ||      ****  ****     | |  ****               |  || **** |  || ||    ****||  *******                    |  |                |   | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           |  |                     |  |     |    | ||  |  |  | |  | |  |          |  |        ***      | | |    | ||      |  |  |  |     | |  |  |               |  || |    |  || ||      ||||  |||||||                    |  |                |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |                     |  |     |    | ||  |  |  | |  | |  |          |  |         |       | ***    | ||      |  |  |  |     | |  |  |               |  || |    |  || ||      ****  ||***||                    |  |                |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..           ****                     ****     |    *******  **** **** ****          ****         |       | | |    ****      ****  ****     ***  ****               |  ****    ********            ||*****                    ****                |   | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                             |                                                  |       *****    | |                                              *****          | |             ||||||                                         |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                             |                                                  |       | |      | |                                                             | |             ||||||                                         ***** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                             |                                                  |       ***      ***                                                             ***             ||||||                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                             *                                                  *                                                                                                ******                                               

   New search    4jnl:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors