triangle PDBeMotif: 4jao  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.3.1.
Classification transferase    | release date: Mon, Feb 18, 2013
Title crystal structure of mycobacterium tuberculosis pks11 reveal intermediates in the synthesis of methyl-branched alkylpyro
Authors J.C.SACCHETTINI, K.GOKULAN, MYCOBACTERIUM TUBERCULOSIS STRUCTU, PROTEOMICS PROJECT (XMTB)
Method X-RAY DIFFRACTION (resolution: 2.05Å)
PDBe Citation   
Small molecules:    search PLM PLM binding statistics PLM   search JAO JAO binding statistics JAO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains D,C,B,A sequence:
MSVIAGVFGALPPHRYSQSEITDSFVEFPGLKEHEEIIRRLHAAAKVNGRHLVLPLQQYPSLTDFGDANEIFIEKAVDLG
VEALLGALDDANLRPSDIDMIATATVTGVAVPSLDARIAGRLGLRPDVRRMPLFGLGCVAGAAGVARLRDYLRGAPDDVA
VLVSVELCSLTYPAVKPTVSSLVGTALFGDGAAAVVAVGDRRAEQVRAGGPDILDSRSSLYPDSLHIMGWDVGSHGLRLR
LSPDLTNLIERYLANDVTTFLDAHRLTKDDIGAWVSHPGGPKVIDAVATSLALPPEALELTWRSLGEIGNLSSASILHIL
RDTIEKRPPSGSAGLMLAMGPGFCTELVLLRWR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : ALPHA-PYRONE SYNTHESIS POLYKETIDE SYNTHASE-LIKE P
member of: UniProt:searchP9WPF2
JMol viewer RasMol script viewer  PLM 400D  ..                                                      *                                                 *                              **                             ** *   *        **  *                                         *                                                                                                              *            
sec str:  ...eeeeeeee....eeehhhhhhhhh....hhhhhhhhhhhhhhh...eee......hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.eeeeee.......hhhhhhhhhhh.....eeeeee.hhhhhhhhhhhhhhhhhh.....eeeeeeeee.hhhhhhh..hhhhhhhhhhh.eeeeeeeeehhhhhhhhh....eeeeeeeee...hhh.eeeeee..eeeeee..hhhhhhhhhhhhhhhhhhh....hhh.eeeeee...hhhhhhhhhhhh......hhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.....eeeeeeee...eeeeeeee..
sequence :  ..SVIAGVFGALPPHRYSQSEITDSFVEFPGLKEHEEIIRRLHAAAKVNGRHLVLPLQQYPSLTDFGDANEIFIEKAVDLGVEALLGALDDANLRPSDIDMIATATVTGVAVPSLDARIAGRLGLRPDVRRMPLFGLGCVAGAAGVARLRDYLRGAPDDVAVLVSVELCSLTYPAVKPTVSSLVGTALFGDGAAAVVAVGDRRAEQVRAGGPDILDSRSSLYPDSLHIMGWDVGSHGLRLRLSPDLTNLIERYLANDVTTFLDAHRLTKDDIGAWVSHPGGPKVIDAVATSLALPPEALELTWRSLGEIGNLSSASILHILRDTIEKRPPSGSAGLMLAMGPGFCTELVLLRWR
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   ||    || |  | ||   || ||  |  |          | |           | || |   |                      | |||||||                      | ||  |      | |  | |            |  |         |  ||  |                              | | |            | |       |  |     | |              |  | | ||| |||    |        |   || |       | ||  | |^***|    |   |     |  | |    |              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||    || |  | ||   || ||  |  |          | |           | || |   |                      | |||||||                      | ||  |      | |  | |            |  |         |  ||  |                              | | |            | |       |  |     | |              |  | | ||| |||    |        |   || |       ^**|  | || | |    |   |     |  | |    |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ||    || |  ^***   ^***|  |  |          | |           | ^***   |                      | |||^***                      | ||  |      | |  | |            |  |         |  ||  |                              | | |            | |       |  |     | |              ^*** | |^***||    |        |   || |          ^*** || | |    |   |     |  | |    |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |^*****| |  | |     |  |  |  |          | |           |  | |   |                      | ||| ||                       | ||  |      | ^*****            |  |         |  ||  |                              | | |            | |       |  |     | |                   | | |  |^*****        |   || |               ^*****    |   |     |  | ^*****              
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   ||     | |  | |     |  |  |  |          | |           |  | *****                      | ||| ||                       | ||  |      | |  |              |  |         |  ||  |                              | | |            | |       |  |     | |                   | | |  |              |   || |                | |      |   |     |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ||     | |  | |     |  |  |  |          | |           |  | |                          | ||| ||                       | ||  |      | |  |              |  |         |  ||  |                              | | |            | |       |  |     | |                   | | |  |              |   || |                ***      |   |     |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..   **     | |  | |     |  |  |  |          | |           |  | |                          | ||| ||                       | ||  |      | |  |              |  |         |  ||  |                              | | |            | |       |  |     | |                   | | |  |              |   || |                         |   |     |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |  | |     ****  ****          | |           **** |                          | |****|                       | ||  |      | ****              |  |         ********                              | | |            | |       ****     | |                   | | |  |              |   || |                         |   |     ****                     
search RasMol script viewer Motif-ligand binding stats  nest ..          | |  | |     |  |                ***              | |                          *** |  |                       ***|  |      ***                 |  |             |  |                              *** |            ***                | |                   *** |  |              |   |***                         |   |     |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..          ***  | |     ****                                 ***                              ****                          ****                          ****             ****                                ***                               | |                       ****              |   |                            |   |     ****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..               | |                                                                                                                                                                                                                              | |                                         *****                            *****                              
search RasMol script viewer Motif-ligand binding stats  stturn ..               ***                                                                                                                                                                                                                              ***                                                                                                             

chain C : ALPHA-PYRONE SYNTHESIS POLYKETIDE SYNTHASE-LIKE P
member of: UniProt:searchP9WPF2
JMol viewer RasMol script viewer  JAO 401C  ..                       *  *                     *        *                                                                              *                             *  *   *            *                                       * *                                                                                 *                            *            
JMol viewer RasMol script viewer  PLM 400D  ..                       |  |                     |        |                                                                              |                             |  |   |            |                                       | |                                                                                 |                            |            
sec str:  ...eeeeeeee...eeeehhhhhhhhh....hhhhhhhhhhhhhhh...eeee..hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.eeeeee.......hhhhhhhhhhh.....eeeeee.hhhhhhhhhhhhhhhhhh.....eeeeeeeee.hhhhhhh..hhhhhhhhhhh.eeeeeeeeehhhhhhhh.....eeeeeeeee...hhh.eeeeee..eeeeee..hhhhhhhhhhhhhhhhhhhh.......eeeeee...hhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh......eeeeeeee...eeeeeeee..
sequence :  ..SVIAGVFGALPPHRYSQSEITDSFVEFPGLKEHEEIIRRLHAAAKVNGRHLVLPLQQYPSLTDFGDANEIFIEKAVDLGVEALLGALDDANLRPSDIDMIATATVTGVAVPSLDARIAGRLGLRPDVRRMPLFGLGCVAGAAGVARLRDYLRGAPDDVAVLVSVELCSLTYPAVKPTVSSLVGTALFGDGAAAVVAVGDRRAEQVRAGGPDILDSRSSLYPDSLHIMGWDVGSHGLRLRLSPDLTNLIERYLANDVTTFLDAHRLTKDDIGAWVSHPGGPKVIDAVATSLALPPEALELTWRSLGEIGNLSSASILHILRDTIEKRPPSGSAGLMLAMGPGFCTELVLLRWR
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   ||    || |  |  |   || || ||| |          | |       |  || || |   |                      | |||||||                      | ||  |      | |    |         |  |  |         |  || ||| |    | || |                 | |              | |  |    |  |     | |          |   |  | | ||| |||    |             | |       | ||  | |^***||  ||    |  | |  | |    |              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||    || |  |  |   || || ||| |          | |       |  || || |   |                      | |||||||                      | ||  |      | |    |         |  |  |         |  || ||| |    | || |                 | |              | |  |    |  |     | |          |   |  | | ||| |||    |             | |       ^**|  | || | ||  ||    |  | |  | |    |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ||    || |  ^***   ^***| ||| |          | |       |  || ^***   |                      | |||^***                      | ||  |      | |    |         |  |  |         |  || ||| |    | || |                 | |              | |  |    |  |     | |          |   ^*** | |^***||    |             | |          ^*** || | ||  ||    |  | |  | |    |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |^*****| |     |   ||  | ||| |          | |       |  ||  | |   |                      | ||| ||                       | ||  |      | ^*****         |  |  |         |  || ||| |    | || |                 | |              | |  |    |  |     | |          |   |    | | |  |^*****             | |               ^*****|  ||    |  | |  | ^*****              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ||     | |     |   ||  | ||| |          | |       |  ||  | |   |                      | ||| ||                       | ||  |      | |              |  |  |         |  || ||| |    | || |                 | |              | |  |    |  |     | |          |   |    | | |  |                   | |                | |  *****    |  | |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   ||     | |     |   ||  | ||| |          | |       |  ||  | *****                      | ||| ||                       | ||  |      | |              |  |  |         |  || ||| |    | || |                 | |              | |  |    |  |     | |          |   |    | | |  |                   | |                | |  |  |     |  | |  |                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ||     | |     |   ||  | ||| |          | |       |  ||  | |                          | ||| ||                       | ||  |      | |              |  |  |         |  || ||| |    | || |                 | |              | |  |    |  |     | |          |   |    | | |  |                   | |                ***  |  |     |  | |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..   **     | |     |   ||  | ||| |          | |       |  ||  | |                          | ||| ||                       | ||  |      | |              |  |  |         |  || ||| |    | || |                 | |              | |  |    |  |     | |          |   |    | | |  |                   | |                     |  |     |  | |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |     |   |**********          | |       ******** |                          | |****|                       | ||  |      | |              ****  |         ********| |    **** |                 | |              | |  |    ****     | |          |   |    | | |  |                   | |                     ****     **** |  |                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |     |   ||  | | |            | |              | |                          | | |  |                       | ||  |      | |                 |  |             |  |***      |  |                 | |              | |  |             | |          |   |    | | |  |                   | |                                   |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..          | |     |   ||  | ***            ***              | |                          *** |  |                       ***|  |      ***                 |  |             |  |         |  |                 ***              ***  |             | |          |   |    *** |  |                   ***                                   |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..          ***     |   |****                                 ***                              ****                          ****                          ****             ****         ****                                    ****             | |          |   |        ****                                                         ****                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  *****                                                                                                                                                                                                                         | |          *****                                                                                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                ***                                                                                                             

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ALPHA-PYRONE SYNTHESIS POLYKETIDE SYNTHASE-LIKE P
member of: UniProt:searchP9WPF2
JMol viewer RasMol script viewer  PLM 400A  ..                                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  JAO 401B  ..                          *                           *                                                 *                              **                             ** *   *        **  *                                       * *                                                                                 *                            *            
sec str:  ...eeeeeeee...eeeehhhhhhhhh....hhhhhhhhhhhhhhh...eeee..hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh.eeeeee.......hhhhhhhhhhh.....eeeeee.hhhhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhhhh..hhhhhhhhhhh.eeeeeeeee..hhhhhh.....eeeeeeeee...hhh.eeeeee..eeeeee.hhhhhhhhhhhhhhhhhhhhh...hhh.eeeeee...hhhhhhhhhhhh......hhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.....eeeeeeee...eeeeeeee..
sequence :  ..SVIAGVFGALPPHRYSQSEITDSFVEFPGLKEHEEIIRRLHAAAKVNGRHLVLPLQQYPSLTDFGDANEIFIEKAVDLGVEALLGALDDANLRPSDIDMIATATVTGVAVPSLDARIAGRLGLRPDVRRMPLFGLGCVAGAAGVARLRDYLRGAPDDVAVLVSVELCSLTYPAVKPTVSSLVGTALFGDGAAAVVAVGDRRAEQVRAGGPDILDSRSSLYPDSLHIMGWDVGSHGLRLRLSPDLTNLIERYLANDVTTFLDAHRLTKDDIGAWVSHPGGPKVIDAVATSLALPPEALELTWRSLGEIGNLSSASILHILRDTIEKRPPSGSAGLMLAMGPGFCTELVLLRWR
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   ||    || |  |  |   || || ||| |          | |           | || |   |                    | ||| || ||             |   |    | ||  |      | |  | |            |  |         |  ||  || |    | ||||              || |||                |  |    |  |     | |              | || ||||| |||    || |          | ||  |   | ||  | |^***|         |  | |  | |    |              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||    || |  |  |   || || ||| |          | |           | || |   |                    | ||| || ||             |   |    | ||  |      | |  | |            |  |         |  ||  || |    | ||||              || |||                |  |    |  |     | |              | || ||||| |||    || |          | ||  |   ^**|  | |    |         |  | |  | |    |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ||    || |  ^***   ^***| ||| |          | |           | ^***   |                    | ||| |^***             |   |    | ||  |      | |  | |            |  |         |  ||  || |    | ||||              || |||                |  |    |  |     | |              ^*** |||^***||    || |          | ||  |      ^*** |    |         |  | |  | |    |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |^*****| |     |   ||  | ||| |          | |           |  | |   |                    | ||| |  |              |   |    | ||  |      | ^*****            |  |         |  ||  || |    | ||||              || |||                |  |    |  |     | |                || ||| |  |^*****| |          | ||  |           ^*****         |  | |  | ^*****              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ||     | |     |   ||  | ||| |          | |           |  | |   |                    | ||| |  |              |   |    | ||  |      | |  |              |  |         |  ||  || |    *****|              || |||                |  |    |  |     | |                *****| |  |      | |          | ||  |                          |  | |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   ||     | |     |   ||  | ||| |          | |           |  | *****                    | ||| |  |              |   |    | ||  |      | |  |              |  |         |  ||  || |    | || |              || |||                |  |    |  |     | |                || ||| |  |      | |          | ||  |                          |  | |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..   **     | |     |   ||  | ||| |          | |           |  | |                        | ||| |  |              |   |    | ||  |      | |  |              |  |         |  ||  || |    | || |              || |||                |  |    |  |     | |                || ||| |  |      | |          | ||  |                          |  | |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |     |   |**********          | |           **** |                        ****| |  |              |   |    | ||  |      | ****              |  |         ********| |    **** |              |****|                |  |    ****     | |                *****| ****      | |          | |****                          **** |  |                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |     |   ||  | | |            | |              | |                          | | |  |              |   |    | ||  |      | |                 |  |             |  |***      |  |              |  | |                |  |             | |                   | | |  |      ***          | |                                   |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..          | |     |   ||  | ***            ***              | |                          *** |  |              |   |    ***|  |      ***                 |  |             |  |         |  |              |  ***                |  |             | |                   *** |  |                   ***                                   |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..          ***     |   |****                                 ***                              ****              |   |       ****                          ****             ****         ****              |    |                ****             | |                       ****                                                         ****                     
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                  |   |                                                                                        |   |                                                                                     ******                                 | |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  |   |                                                                                        *****                                                                                                                            | |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  *****                                                                                                                                                                                                                         | |                                                                                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                ***                                                                                                             

chain A : ALPHA-PYRONE SYNTHESIS POLYKETIDE SYNTHASE-LIKE P
member of: UniProt:searchP9WPF2
JMol viewer RasMol script viewer  PLM 400A  ..                       *                          *                                                     *                              **                             ** *            **  *                                       * *        *                                                                                                     *            
JMol viewer RasMol script viewer  JAO 401B  ..                       |                          |                                                     |                              ||                             || |            ||  |                                       | |        |                                                                                                     |            
sec str:  ...eeeeeeee...eeeehhhhhhhhh....hhhhhhhhhhhhhhh...eeee..hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.eeeeee.......hhhhhhhhhhh.....eeeeee.hhhhhhhhhhhhhhhhhhh....eeeeeeeee.hhhhhhh..hhhhhhhhhhh.eeeeeeeee.............eeeeeeeee...hhh.eeeeee..eeeeee.hhhhhhhhhhhhhhhhhhhhh.......eeeeee...hhhhhhhhhhhh......hhhhhhhhhhh...hhhhhhhhhhhhhhh......eeeeeeee...eeeeeeee..
sequence :  ..SVIAGVFGALPPHRYSQSEITDSFVEFPGLKEHEEIIRRLHAAAKVNGRHLVLPLQQYPSLTDFGDANEIFIEKAVDLGVEALLGALDDANLRPSDIDMIATATVTGVAVPSLDARIAGRLGLRPDVRRMPLFGLGCVAGAAGVARLRDYLRGAPDDVAVLVSVELCSLTYPAVKPTVSSLVGTALFGDGAAAVVAVGDRRAEQVRAGGPDILDSRSSLYPDSLHIMGWDVGSHGLRLRLSPDLTNLIERYLANDVTTFLDAHRLTKDDIGAWVSHPGGPKVIDAVATSLALPPEALELTWRSLGEIGNLSSASILHILRDTIEKRPPSGSAGLMLAMGPGFCTELVLLRWR
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   ||    || |  |  ||  || || | |            | |           | || |   |                   || |||||||||     | |              | ||  |      | |    |            |  |         |  ||  || |    | ||||             || || | |            | |       |  |     | |         ||  || || ||||| |||    |        | ||||||| |||  | ||  | |^***|              |  | |    |              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||    || |  |  ||  || || | |            | |           | || |   |                   || |||||||||     | |              | ||  |      | |    |            |  |         |  ||  || |    | ||||             || || | |            | |       |  |     | |         ||  || || ||||| |||    |        | ||||||| |||  ^**|  | |    |              |  | |    |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ||    || |  ^***|  ^***| | |            | |           | ^***   |                   || |||||^***     | |              | ||  |      | |    |            |  |         |  ||  || |    | ||||             || || | |            | |       |  |     | |         ||  |^*** |||^***||    |        | ||||||| |||     ^*** |    |              |  | |    |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |^*****| |  |  ||  ||  | | |            | |           |  | |   |                   || ||||| ||      | |              | ||  |      | ^*****            |  |         |  ||  || |    | ||||             || || | |            | |       |  |     | |         ||  || || ||||| ||^*****        | ||||||| |||          ^*****              |  | ^*****              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ||     | |  |  ||  ||  | | |            | |           |  | |   |                   || ||||| ||      | |              | ||  |      | |                 |  |         |  ||  || |    *****|             ***** | |            | |       |  |     | |         ||  || || ||||| ||              | ||||||| |||                              |  |                     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   ||     | |  |  ||  ||  | | |            | |           |  | *****                   || ||||| ||      | |              | ||  |      | |                 |  |         |  ||  || |    | || |             || || | |            | |       |  |     | |         ||  || || ||||| ||              | ||||||| |||                              |  |                     
search RasMol script viewer Motif-ligand binding stats  betabulge ..   **     | |  |  ||  ||  | | |            | |           |  | |                       || ||||| ||      | |              | ||  |      | |                 |  |         |  ||  || |    | || |             || || | |            | |       |  |     | |         ||  || || ||||| ||              | ||||||| |||                              |  |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |  |  ||  ||  | | |            | |           **** |                       |****|****|      | |              | ||  |      | |                 |  |         ********| |    **** |             ****| | |            | |       ****     | |         ||  || *****|****|              | |****|****|                              ****                     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..          | |  |  ||  ||  | | |            | |              | |                       |  | | |  |      | |              | ||  |      | |                 |  |             |  |***      |  |              |  | | |            | |                | |         ||  ||    | | |  |              | | || |  | |                              |  |                     
search RasMol script viewer Motif-ligand binding stats  nest ..          | |  |  ||  ||  | ***            ***              | |                       |  *** |  |      | |              ***|  |      ***                 |  |             |  |         |  |              |  | | |            ***                | |         ||  ||    *** |  |              | | |***  ***                              |  |                     
search RasMol script viewer Motif-ligand binding stats  niche ..          ***  |  ||  |****                                 ***                       |    | ****      | |                 ****                          ****             ****         ****              **** ***                               | |         ||  ||        ****              | | |  |                                   ****                     
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..               |  ||  |                                                               ******           | |                                                                                                                                      | |         ||  ||                          | ******                                                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..               *****  |                                                                                | |                                                                                                                                      | |         ||  ||                          |   |                                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  *****                                                                                | |                                                                                                                                      | |         ******                          *****                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                       ***                                                                                                                                      ***                                                                                                             

   New search    4jao:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors