triangle PDBeMotif: 4j3e  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   6.3.2.
Classification ligase/antagonist    | release date: Tue, Feb 5, 2013
Title the 1.9a crystal structure of humanized xenopus mdm2 with nu
Authors B.J.GRAVES, C.M.LUKACS, R.CROWTHER, R.U.KAMMLOTT
Method X-RAY DIFFRACTION (resolution: 1.91Å)
PDBe Citation   
Small molecules:    search NUT NUT binding statistics NUT   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MEKLVQPTPLLLSLLKSAGAQKETFTMKEVLYHLGQYIMAKQLYDEKQQHIVHCSNDPLGELFGVQEFSVKEHRRIYAMI
SRNLVS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : E3 UBIQUITIN-PROTEIN LIGASE MDM2
member of: GENE3D:searchG3DSA_1.10.245.10PANTHER:searchPTHR10360/searchPTHR10360_SF9PFAM:searchPF02201PFAMB:searchPB003487PIRSF:searchPIRSF006748/searchPIRSF500700SUPERFAMILY:searchSSF47592UniProt:searchP56273
JMol viewer RasMol script viewer  SO4 202A  ..                                                                       * **           
JMol viewer RasMol script viewer  NUT 201A  ..                              *  *** **            *               * * |*||**         
sec str:  .........hhhhhhhhhhh.......hhhhhhhhhhhhhhhhh........eee....hhhhhhh..eee..hhhhhhhhhhh....
sequence :  ..MEKLVQPTPLLLSLLKSAGAQKETFTMKEVLYHLGQYIMAKQLYDEKQQHIVHCSNDPLGELFGVQEFSVKEHRRIYAMISRNLVS
seq num:  ..20        30        40        50        60        70        80        90        100   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              || |||     ^**||          |||||  |  |  |  | ||| | |   ^**||      || ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              || |||     ^***|          |||||  |  |  |  | ||| | |   ^***|      || ||  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..              || |||     |   |          |||||  |  |  |  ***** | |   | |||      || ||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..              || |||     |   |          |||||  |  |  |  ***|  | |   | |||      || ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |****|     |   |          |||||  ****  |  ****  | |   ****|      ****|  
search RasMol script viewer Motif-ligand binding stats  nest ..              |  ***     |   |          ****|  |  |  |  |     ***   | | |       |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..              |    |     |   |           **********  ****           | | |       ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..              ******     |   |                                      | | |             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                         *****                                      *****             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                    ***               

   New search    4j3e:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors