triangle PDBeMotif: 4j0h  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification hydrolase    | release date: Wed, Jan 30, 2013
Title tannin acyl hydrolase in complex with gallic acid
Authors B.REN, H.WEN, M.WU, Q.CHEN, Q.WANG, W.J.MCKINSTRY, X.PENG
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search PG4 PG4 binding statistics PG4   search PEG PEG binding statistics PEG   search GDE GDE binding statistics GDE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MHHHHHHSSGVDLGTENLYFQSMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSS
VNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKA
AIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEW
QFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQ
LLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTR
STVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLG
DLFSWIDGLCQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TANNASE
member of: GENE3D:searchG3DSA_3.40.50.1820PFAMB:searchPB007857/searchPB016433SUPERFAMILY:searchSSF53474UniProt:searchB3Y018
JMol viewer RasMol script viewer  PEG 505A  ..                                                                                                                                                                                                                                                                                                 *   **  *                                                                                                                                                                            
JMol viewer RasMol script viewer  PEG 504A  ..                                                                                                                                                                                                                                                                                                 |   ||  |                                                                                                                                     *   *                                  
JMol viewer RasMol script viewer  PEG 503A  ..                                                                                                                                                                                                                          *                                           *                        ***   *|  |                                  **  *                                                                                              |   |                                  
JMol viewer RasMol script viewer  PG4 502A  ..                                                                                                                                                                                    *                                     |                                           |                        |||   ||  |                                  ||  |                                                                                              |   |                                  
JMol viewer RasMol script viewer  GDE 501A  ..                                                                            ***                                                                                    **               |                         *           |                                           |                        |||   ||  |                                  ||  |      *             *                                                               *         |   |               *                  
sec str:  ..........hhhhheeeeeee..eeeeeeeeeeee..........eeeeeee.hhhh.............eeee.....................hhhhhhhhhhh..eeeee..................hhhhhhhhhhhhhhhhh..........eeee..hhhhhhhhhhhhh..hhhhhhhhhhhh.........eeeee....hhhhhhhhhhhhhh...eeeeeeeeeee.....eeeeeeeee.hhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhh..hhhhh..eeee..eeeeehhhhhhhhhh..............hhhhhhh..........hhhhhhh........hhhhhhhh..hhhhhh.......eeeee.........hhhhhhhhhhhhhh..eeeee...........hhhhhhhhhhhhhh
sequence :  ..SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| ||| |  |  |      |  |      |  |                  || |||| | || |  |     | ||  |     |  | |           | |||        | || | ||| | |               |  || |         ^***| | |  | | || | |     | |||   |             | |       | || | |        |||||||          |  ||                | ||  |||  ||||||| | ||           ||||||| |  |  |   |   || |         | |      | |||| | |  || |||        |  |       |   ||  |   |  |             |  | ||| |           | ||    ||  |    | |     |  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ^** |  |  |      |  |      |  |                  || |||| | || |  |     | ||  |     |  | |           | |||        | || | ||| | |               |  || |          |  | | |  | | || | |     | |||   |             | |       | || | |        |^**|||          |  ||                | ||  |||  ||||||| ^**|           ||||||| |  |  |   |   || |         | |      | |||| | |  || ^**        |  |       |   ||  |   |  |             |  | ||| |           | ||    ||  |    | |     |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| ||| |  |  |      |  |      |  |                  || |||| | || |  |     | ||  |     |  | |           | |||        | ^*** ||| | |               |  || |          |  | | |  | | || | |     | |||   |             | |       | || | |        | | |||          ^***|                | |^***||  ^***||| ^***           ^***||| |  |  |   |   ^***         | |      | ||^*** |  ||  |         |  |       |   ||  |   |  |             |  | ||| |           | ||    ||  |    | |     ^***    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ||| |  |  |      |  |      |  |                  || ||^*****| |  |     | ||  |     |  | |           | |||        |  | | |^*****               |  || |          ^***** |  | ^***** |     | |^*****             | |       | || | |        ^*****|          |   |                | |   |^*****| |||                 || ||| |  |  |   ^*****           | |      | |||| | |  ||  |         |  |       |   ||  |   |  |             |  | ||| |           | |^*****|  |    | |             
search RasMol script viewer Motif-ligand binding stats  asxmotif ..| ||| |  |  |      |  |      |  |                  || || | |  | |  |     | ||  |     |  | |           | |||        |  | | ||| | |               |  || |             |   |  | | || | |     | |||                 | |       | || | |          | |||          |   |                | |   | |    | |||                 || ||| |  |  |                    | |      | |||| | |  ||  |         |  |       *****|  |   |  |             |  | ||| |           | |      |  |    | |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..| ||| |  |  |      |  |      |  |                  || || | |  | |  |     ***|  |     |  | |           | |||        |  | | ||| | |               |  || |             |   |  | | || | |     | |||                 | |       | || | |          | |||          |   |                | |   ***    | |||                 || ||| |  |  |                    | |      | |||| | |  ||  |         |  |            |  |   |  |             |  ***|| |           | |      |  |    | |             
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..| ||| |  |  |      |  |      |  |                  || || | |  | |  |     | ||  |     |  | |           | |||        |  | ***** | |               |  || |             |   |  | | || | |     | |||                 | |       | || | |          *****          |   |                | |   | |    *****                 || ||| |  |  |                    | |      | |||| | |  ||  |         |  |            |  |   |  |             |  |  || |           | |      |  |    | |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..| ||| |  |  |      ****      |  |                  ***** | **** |  |     | |****     **** |           ****|        **** ****| | |               |  || |             |   |  | | **** |     ****|                 | |       | **** |          ****|          |   |                | |   | |    ****|                 *****| |  |  |                    | |      ****|| | ****|  |         |  |            |  |   |  |             ****  || |           | |      ****    | |             
search RasMol script viewer Motif-ligand binding stats  nest ..| ||***  |  |                |  |                      ***      |  |     | |         |  | |             ***        |  |   *** | |               |  || |             |   |  | | || | |       ***                 ***       | || | |            ***          |   |                ***   ***      ***                    *** |  |  |                    | |        **** | |  ||  |         |  |            |  |   |  |             |  |  || |           ***      |  |    ***             
search RasMol script viewer Motif-ligand binding stats  niche ..****     ****                ****                               ****     ***         ******                        ****       ***               *******             |   |  | ****** |                                     ********                         |   |                                                          *******                    ***         *** | ********         ****            ****   ****             *******| |                    ****                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..| |                                                                                                                                                                 |   |  |   |  | |                                                                      *****                                                                                                   | |                                                                 | |                                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..| |                                                                                                                                                                 *****  *****  | |                                                                                                                                                                              | |                                                                 | |                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..***                                                                                                                                                                               ***                                                                                                                                                                              ***                                                                 ***                                            

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : TANNASE
member of: GENE3D:searchG3DSA_3.40.50.1820PFAMB:searchPB007857/searchPB016433SUPERFAMILY:searchSSF53474UniProt:searchB3Y018
JMol viewer RasMol script viewer  PEG 506B  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      
JMol viewer RasMol script viewer  PEG 505B  ..                                                                                                                                                                                                                                                                                                                                    **                                                                                                                                                
JMol viewer RasMol script viewer  PEG 504B  ..                                                                                                                                                                                                                                                                                                       *                            ||                                                                                                         *         *                            
JMol viewer RasMol script viewer  PEG 503B  ..                                                                                                                                                                                                                          *                                           *                        ***   * |                            ||      **  *                                                                                              |         |                            
JMol viewer RasMol script viewer  PG4 502B  ..                                                                                                                                                *          *                                                              |                                           |                        |||   | |                            ||      ||  |                                                                                              |         |                            
JMol viewer RasMol script viewer  GDE 501B  ..                                                                            ***                                                                 |          |       **                                         *           |                                           |                        |||   | |                            ||      ||  |      *             *                                                               *         |         |         *                  
sec str:  ..........hhhhheeeeeee..eeeeeeeeeeee..........eeeeeee.hhhh.............eeee.....................hhhhhhhhhhhh.eeeee..................hhhhhhhhhhhhhhhhh..........eeee..hhhhhhhhhhhhh..hhhhhhhhhhhh.........eeeee....hhhhhhhhhhhhhh...eeeeeeeeeee.....eeeeeeeee.hhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhh...hhhhh..eeee..eeeeehhhhhhhhhh..............hhhhhhh..........hhhhhhh........hhhhhhhh.hhhhhh........eeeee.........hhhhhhhhhhhhhh..eeeee...........hhhhhhhhhhhhhh
sequence :  ..SMSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVPAAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRLPGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAVSAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQLTVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLLISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQLDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYLTTTSSQVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIPHSGDYDLGDLFSWIDGLCQ
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| ||| | || ||      |  |      |  |         | |          ||| | |||| ||     | |         | ||||           | |||        | || | ||| | |               |  || |  | |||  ^***|||||    | || | |     | |||   | |           | |       | || | |        || ||||          | ||                 | ||| |||  ||||||| | ||           |||||||    |  |   |   || |         | |      | |||| | |  || |||        |  |       |   ||  |  ||  |             |  | ||| |||       | ||||    ||  |    | |     |  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ^** | || ||      |  |      |  |         | |          ||| | |||| ||     | |         | ||||           | |||        | || | ||| | |               |  || |  | |||   ||||||||    | || | |     | |||   | |           | |       | || | |        |^**|||          | ||                 | ||| |||  ||||||| ^**|           |||||||    |  |   |   || |         | |      | |||| | |  || ^**        |  |       |   ||  |  ||  |             |  | ||| |||       | ||||    ||  |    | |     |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| ||| | || ||      |  |      |  |         | |          ||| | |||| ||     | |         | ||||           | |||        | ^*** ||| | |               |  || |  | |||   ||||||||    | || | |     | |||   | |           | |       | || | |        |   |||          ^***                 | |^***||  ^***||| ^***           ^***|||    |  |   |   ^***         | |      | ||^*** |  ||  |         |  |       |   ||  |  ||  |             |  | ||| |||       | ||||    ||  |    | |     ^***    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ||| | || ||      |  |      |  |         | |          |^*****||| ||     | |         | ||||           | |||        |  |   |^*****               |  || |  | |||   ^*****||    ^***** |     | |^***** |           | |       | || | |        ^*****|          | |                  | | | |^*****| |||                 || |||    |  |   ^*****           | |      | |||| | |  ||  |         |  |       |   ||  |  ||  |             |  | ||| |||       | |||^*****|  |    | |             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| ||| | || ||      |  |      |  |         | |          | | |  ||| ||     | |         | ||||           | |||        |  |   | | | |               |  || |  | |||    |*****|    | || | |     | |||   | |           | |       | || | |            | |          | |                  | | | |||    | |||                 || |||    |  |                    | |      | |||| | |  ||  |         |  |       |   ||  |  ||  |             |  | ||| |||       | |||      |  |    | |             
search RasMol script viewer Motif-ligand binding stats  asxmotif ..| ||| | || ||      |  |      |  |         | |          | | |  ||| ||     | |         *****|           | |||        |  |   | | | |               |  || |  *****    ||||| |    | || | |     | |||   | |           | |       | || | |            | |          | |                  | | | |||    | |||                 || |||    |  |                    | |      | |||| | |  ||  |         |  |       *****|  |  ||  |             |  | ||| |||       | |||      |  |    | |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..| ||| | || ||      |  |      |  |         | |          | | |  ||| ||     ***         ***| |           | |||        |  |   | | | |               |  || |  ***|     ||||| |    | || | |     | |||   | |           | |       | || | |            | |          | |                  | | | ***    | |||                 || |||    |  |                    | |      | |||| | |  ||  |         |  |            |  |  ||  |             |  ***|| |||       | |||      |  |    | |             
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..| ||| | || ||      |  |      |  |         | |          | | |  ||| ||     | |         |  | |           | |||        |  |   | | | |               |  || |  |  |     ||||| |    | || | |     | |||   | |           | |       | || | |            | |          | |                  | | *****    *****                 || |||    |  |                    | |      | |||| | |  ||  |         |  |            |  |  ||  |             |  |  || |||       | |||      |  |    | |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..| ||| | ****|      ****      |  |         | |          | | ********|     | |         **** |           ****|        |  |   | | | |               |  || |  ****     ***** |    | **** |     ****|   | |           | |       | **** |            | |          | |                  | | ****|    ****|                 *****|    |  |                    | |      ****|| | ****|  |         |  |            |  |  ||  |             ****  |****|       ****|      |  |    | |             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..| ||| |  |  |                |  |         ***          | |      |  |     | |         |  | |             | |        |  |   | | | |               |  || |             |   |    | || | |       | |   | |           | |       | || | |            | |          | |                  | |   | |      | |                 |  | |    |  |                    | |        |||| | |  ||  |         |  |            |  |  ||  |             |  |  || | |         | |      |  |    | |             
search RasMol script viewer Motif-ligand binding stats  nest ..| ||***  |  |                |  |                      ***      |  |     | |         |  | |             ***        |  |   *** | |               |  || |             |   |    | || | |       ***   | |           ***       | || | |            ***          | |                  ***   ***      ***                 |  ***    |  |                    | |        **** | |  ||  |         |  |            |  |  ||  |             |  |  || | |         ***      |  |    ***             
search RasMol script viewer Motif-ligand binding stats  niche ..****     ****                ****                               ****     ***         ******                        ****       ***               *******             |   |    ****** |             ***                     ********                         | |                                                     |    |    ****                    ***         *** | ********         ****            ****  |****             *******| | |                  ****                    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..| |                                                                                                                                                                 |   |         | |                                                                      | |                                                     ******                                          | |                                        |   |                    | | |                                          
search RasMol script viewer Motif-ligand binding stats  stmotif ..| |                                                                                                                                                                 |   |         | |                                                                      | |                                                                                                     | |                                        |   |                    *****                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..| |                                                                                                                                                                 *****         | |                                                                      | |                                                                                                     | |                                        *****                    | |                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..***                                                                                                                                                                               ***                                                                      ***                                                                                                     ***                                                                 ***                                            

   New search    4j0h:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors