triangle PDBeMotif: 4ixu  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification hydrolase/hydrolase inhibitor    | release date: Mon, Jan 28, 2013
Title crystal structure of human arginase-2 complexed with inhibit {(5r)-5-amino-5-carboxy-5-[(3-endo)-8-(3,4-dichlorobenzyl)- azabicyclo[3.2.1]oct-3-yl]pentyl}(trihydroxy)borate(1-)
Authors A.COUSIDO-SIAH, A.GOLEBIOWSKI, A.MITSCHLER, A.PODJ, D.WHITEHOUSE, F.X.RUIZ, H.SCHROETER, J.OLCZAK, M, M.ANDREOLI, M.K.JI, M.MAZUR, P.BECKETT, R.JAGDMANN, T.RYDER, W.CZESTKOWSKI, W.PIOTROWSKA, ZANDT
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search MN MN binding statistics MN   search BEN BEN binding statistics BEN   search BME BME binding statistics BME   search 38I 38I binding statistics 38I
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVV
SRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSW
IKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPAT
GTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARGINASE-2, MITOCHONDRIAL
JMol viewer RasMol script viewer  38I 406A  ..                                                                                                *                      * * * *     **   **                                        *                                                * *           *                              *                                 
JMol viewer RasMol script viewer  BME 405A  ..                                                                                                |            **        | | | |     ||   ||                                        |                                                | |           |                        *     |                                 
JMol viewer RasMol script viewer  BME 404A  ..  *                               *    *                                                        |            ||        | | | |     ||   ||                                        |                                                | |           |                        |     |                          *      
JMol viewer RasMol script viewer  BEN 403A  ..  |                               |    |                   **                                   |            ||        | | | |     ||   ||                                        |                                                | |           |                        |     |                          |      
JMol viewer RasMol script viewer  MN 402A  ..  |                               |    |                   ||                                   |            ||        * | | |     ||   ||                                        |                                                | |           |                        |     |                          |      
JMol viewer RasMol script viewer  MN 401A  ..  |                               |    |                   ||                                   *            ||        * | * |     ||   ||                                        |                                                | |           |                        |     |                          |      
sec str:  ...eeeeeee.........hhhhhhhhhhhhhhhhhhhhh..eeeeeee.................hhhhhhhhhhhhhhhhhhhhhh..eeeeee...hhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhhhhhh.............hhh.eeeeee...hhhhhhhhhhh..eeeehhhhhhhhhhhhhhhhhhhhhh.....eeeeee.hhh................hhhhhhhhhhhhhhh..eeeeeee..hhhhh.hhhhhhhhhhhhhhhhhhhh......
sequence :  ..HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREG
seq num:  ..24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324   
search RasMol script viewer Motif-ligand binding stats  PS00004 ..      || | | | | |||||    | ||||**^* |||   | |              | |                   || |||     | | |||||  | |   |  |        ||||||||| ||||  | || ||   |  |    ||| |    ||||| |  |           | | | | | ||                 |  |      | ||| ||  ||         | | |||    |    ||||| |||  |||| ||  ||   |           | || | 
search RasMol script viewer Motif-ligand binding stats  PS00005 ..      || | | | | |||||    | ||||  || |||   | |              | |                   || |||     | | |||||  | |   |  |        ||||||||| ||||  | || ||   |  |    ||| |    ||||| |  |           | | | | ^**|                 |  |      | ||| ||  ||         | ^**||    |    ||||| |||  |||| ||  ||   |           | || | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      || | | | | |||||    | ||||  || |||   | |              | |                   || |||     | | |||||  | |   |  |        ||||||||| ||||  | || ||   |  |    ||| |    ||||| |  |           | | | | ^***                 |  |      | ||| ||  ||         | ^***|    |    ||||^***|  |||| |^***|   |           | || | 
search RasMol script viewer Motif-ligand binding stats  PS00007 ..      || | | | | |||||    | ||||  || |||   | |              | |                   || |||     | | |||||  | |   |  |        ||||||||| ||||  | || ||   |  |    ||| |    ||||| |  |           ******^ | |                  |  |      | ||| ||  ||         | |   |    |    ||||  | |  |||| |    |   |           | || | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      ^***** | | |||||    | ||||  || |||   | |              | |                   || |||     ^*****||^*****   |  |        ||||||||| |^***** || ||   |  |    ||| |    ||||| |  |             | |   | |                  |  |      | ||| ||  ||         | |   ^*****    |^***** |  |||| |    |   |           | || | 
search RasMol script viewer Motif-ligand binding stats  PS00009 ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       | ||||   |     |  |        ||||||||| | ||  | || ||   |  |    ||| |    ||||| |  |             | |   | |                  ^***      | ||| ||  ||         | |   |         ||||    |  |||| |    |   |           | || | 
search RasMol script viewer Motif-ligand binding stats  PS01053 ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       | ||||   |     |  |        ||||||||| | ||  | || ||   |  |    ||| |    ||||| |  |             | |   | |                  |  |      **^*^***************** |   |         ||||    |  |||| |    |   |           | || | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       | ||||   |     |  |        ||||||||| | ||  | || ||   |  |    ||| |    ||||| |  |             | |   | |                  |  |        ||| |*****           |   |         ||||    |  |||| |    |   |           | || | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       *****|   |     |  |        ||||||||| | ||  | || ||   |  |    ||| |    ||||| |  |             | |   | |                  |  |        ||| ||  |            |   |         ||||    |  |||| |    |   |           | || | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |   | | |||||    | ||||  || |||   ***              | |                   || |||       ***| |   |     |  |        ||||||||| | ||  | || ||   |  |    ||| |    ||||| |  |             | |   | |                  |  |        *** ||  |            |   |         ||||    |  |*** |    |   |           | || | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |   | | *****    ****||  |****|                    | |                   |****|       **** |   |     |  |        ||||****| | |**** ****|   |  |    ||| |    ****| |  |             | |   | |                  |  |         |  |****            |   |         ||||    |  | |  |    |   |           | || | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***   | | | |        ||||  |  | |                    | |                   |  | |            |   |     |  |        ||||||| | | |      |  |   |  |    ||| |    ||| | |  |             | |   | |                  |  |         |  |                |   |         ||||    |  | |  |    |   |           | || | 
search RasMol script viewer Motif-ligand binding stats  nest ..             | | ***        ****  |  ***                    ***                   |  ***            |   |     |  |        ****||| | ***      |  |   |  |    *** |    ||| | |  |             ***   | |                  |  |         |  |                |   |         ****    |  | |  |    |   |           ***| | 
search RasMol script viewer Motif-ligand binding stats  niche ..             ***                  |    |                                          |    |            |   |     ****         ***|**** | |      ****   ****     ****    |**** ****                   | |                  ****         ****                |   |         |***    **** ****    |   |              | | 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                  ******                                          ******            |   |                     | | | | |                              | | |                        | |                                                   |   |         | |                  |   |              | | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                    |   |                     ***** | |                              *****                        | |                                                   *****         | |                  |   |              | | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                    *****                     | | | | |                              | |                          | |                                                                 | |                  *****              | | 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                              *** *****                              ***                          ***                                                                 ***                                     *** 

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ARGINASE-2, MITOCHONDRIAL
JMol viewer RasMol script viewer  38I 406B  ..                                                                                                *                      * * *       **   **                                        *                                                * *           *                              *                                 
JMol viewer RasMol script viewer  BME 404B  ..* *                                   **                                                        |                      | | |       ||   ||                                        |                                                | |           |                              |                          *      
JMol viewer RasMol script viewer  BEN 403B  ..| |                                   ||                   **                                   |                      | | |       ||   ||                                        |                                                | |           |                              |                          |      
JMol viewer RasMol script viewer  MN 402B  ..| |                                   ||                   ||                                   |                      * | |       ||   ||                                        |                                                | |           |                              |                          |      
JMol viewer RasMol script viewer  MN 401B  ..| |                                   ||                   ||                                   |                      * | *       ||   ||                                        |                                                | |           |                              |                          |      
sec str:  ...eeeeee..........hhhhhhhhhhhhhhhhhhhhh..eeeeeee.................hhhhhhhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhhhhhh.............hhh.eeeeee...hhhhhhhhhhh..eeeehhhhhhhhhhhhhhhhhhhhhh.....eeeeee.hhh................hhhhhhhhhhhhhhh..eeeeeee..hhhhh.hhhhhhhhhhhhhhhhhhhh......
sequence :  ..HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREG
seq num:  ..24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324   
search RasMol script viewer Motif-ligand binding stats  PS00004 ..      || | | | | |||||    | ||||**^* |||   | |              | |                   || |||     | | ||| |    |   |  |        ||||||||| ||||  |  |  |   |  |    ||| |    || || |  |           | | | | | ||        |   |    |  |      | ||| ||  ||| |      | | |||    |    ||||| |||  |||| ||| | |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS00005 ..      || | | | | |||||    | ||||  || |||   | |              | |                   || |||     | | ||| |    |   |  |        ||||||||| ||||  |  |  |   |  |    ||| |    || || |  |           | | | | ^**|        |   |    |  |      | ||| ||  ||| |      | ^**||    |    ||||| |||  |||| ||| | |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      || | | | | |||||    | ||||  || |||   | |              | |                   || |||     | | ||| |    |   |  |        ||||||||| ||||  |  |  |   |  |    ||| |    || || |  |           | | | | ^***        |   |    |  |      | ||| ||  ||| |      | ^***|    |    ||||^***|  |||| |^*** |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS00007 ..      || | | | | |||||    | ||||  || |||   | |              | |                   || |||     | | ||| |    |   |  |        ||||||||| ||||  |  |  |   |  |    ||| |    || || |  |           ******^ | |         |   |    |  |      | ||| ||  ||| |      | |   |    |    ||||  | |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      ^***** | | |||||    | ||||  || |||   | |              | |                   || |||     ^*****| ^*****   |  |        ||||||||| |^*****  |  |   |  |    ||| |    || || |  |             | |   | |         |   |    |  |      | ||| ||  ||| |      | |   ^*****    |^***** |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS00009 ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       | |||          |  |        ||||||||| | ||  |  |  |   |  |    ||| |    || || |  |             | |   | |         |   |    ^***      | ||| ||  ||| |      | |   |         ||||    |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS01053 ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       | |||          |  |        ||||||||| | ||  |  |  |   |  |    ||| |    || || |  |             | |   | |         |   |    |  |      **^*^***************** |   |         ||||    |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       | |||          |  |        ||||||||| | ||  |  |  |   |  |    ||| |    || || |  |             | |   | |         |   |    |  |        ||| |*****| |        |   |         ||||    |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       *****          |  |        ||||||||| | ||  |  |  |   |  |    ||| |    || || |  |             | |   | |         |   |    |  |        ||| ||  | | |        |   |         ||||    |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |   | | |||||    | ||||  || |||   ***              | |                   || |||       ***|           |  |        ||||||||| | ||  |  |  |   |  |    ||| |    || || |  |             | |   | |         |   |    |  |        *** ||  | | |        |   |         ||||    |  |*** | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |   | | *****    ****||  |****|                    | |                   |****|       ****           |  |        ||||****| | |****  |  |   |  |    ||| |    ****| |  |             | |   | |         |   |    |  |         |  |**** | |        |   |         ||||    |  | |  | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***   | | | |        ||||  || | |                    | |                   |  | |                      |  |        ||||||| | | |      |  |   |  |    ||| |     |  | |  |             | |   | |         |   |    |  |         |  |     ***        |   |         ||||    |  | |  | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  nest ..             | | ***        ****  || ***                    ***                   |  ***                      |  |        ****||| | ***      |  |   |  |    *** |     |  | |  |             ***   | |         |   |    |  |         |  |                |   |         ****    |  | |  | |   |              ***| | 
search RasMol script viewer Motif-ligand binding stats  niche ..             ***               |  ||   |                                          |    |                      ****         ***|**** | |      ****   ****     ****     **** ****                   | |         |   |    ****         ****                |   |         |***    **** **** |   |                 | | 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                               |  ******                                          ******                                      | | | | |                                                           | |         |   |                                     |   |         | |               |   |                 | | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               |   |                                                                                          ***** | |                                                           | |         |   |                                     *****         | |               *****                 | | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****                                                                                          | | | | |                                                           | |         *****                                                   | |                                     | | 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                              *** *****                                                           ***                                                                 ***                                     *** 

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : ARGINASE-2, MITOCHONDRIAL
JMol viewer RasMol script viewer  38I 406C  ..                                                                                                *                      * * *        *   **                                        **                                               * *           *                              *                                 
JMol viewer RasMol script viewer  BME 405C  ..                                                                                   *            |         *  ***       | | |        |   ||                                        ||                                         *     | |           |                              |                                 
JMol viewer RasMol script viewer  BME 404C  ..* *                               *    *                                           |            |         |  |||       | | |        |   ||                                        ||                                         |     | |           |                              |                          *      
JMol viewer RasMol script viewer  BEN 403C  ..| |                               |    |                   **                      |            |         |  |||       | | |        |   ||                                        ||                                         |     | |           |                              |                          |      
JMol viewer RasMol script viewer  MN 402C  ..| |                               |    |                   ||                      |            *         |  |||       * | *        |   ||                                        ||                                         |     | |           |                              |                          |      
JMol viewer RasMol script viewer  MN 401C  ..| |                               |    |                   ||                      |            |         |  |||       * * |        |   ||                                        ||                                         |     | |           |                              |                          |      
sec str:  ...eeeeee..........hhhhhhhhhhhhhhhhhhhhh..eeeeeee.................hhhhhhhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhhhhhh.............hhh.eeeeee...hhhhhhhhhhh..eeeehhhhhhhhhhhhhhhhhhhhhh.....eeeeee.hhh................hhhhhhhhhhhhhhh..eeeeeee..hhhhh.hhhhhhhhhhhhhhhhhhhh......
sequence :  ..HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREG
seq num:  ..24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324   
search RasMol script viewer Motif-ligand binding stats  PS00004 ..      || | | | | |||||    | ||||**^* |||   | |              | |                   || |||     | | ||| |    |   |  |        ||||||||| ||||  | || ||   |  |    ||| |    || || |  |           | | | | | ||        |   |    |  |      | ||| ||  ||| |      | | |||    |    ||||| |||  |||| ||| | |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS00005 ..      || | | | | |||||    | ||||  || |||   | |              | |                   || |||     | | ||| |    |   |  |        ||||||||| ||||  | || ||   |  |    ||| |    || || |  |           | | | | ^**|        |   |    |  |      | ||| ||  ||| |      | ^**||    |    ||||| |||  |||| ||| | |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..      || | | | | |||||    | ||||  || |||   | |              | |                   || |||     | | ||| |    |   |  |        ||||||||| ||||  | || ||   |  |    ||| |    || || |  |           | | | | ^***        |   |    |  |      | ||| ||  ||| |      | ^***|    |    ||||^***|  |||| |^*** |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS00007 ..      || | | | | |||||    | ||||  || |||   | |              | |                   || |||     | | ||| |    |   |  |        ||||||||| ||||  | || ||   |  |    ||| |    || || |  |           ******^ | |         |   |    |  |      | ||| ||  ||| |      |     |    |    ||||  | |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..      ^***** | | |||||    | ||||  || |||   | |              | |                   || |||     ^*****| ^*****   |  |        ||||||||| |^***** || ||   |  |    ||| |    || || |  |             | |   | |         |   |    |  |      | ||| ||  ||| |      |     ^*****    |^***** |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS00009 ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       | |||          |  |        ||||||||| | ||  | || ||   |  |    ||| |    || || |  |             | |   | |         |   |    ^***      | ||| ||  ||| |      |               ||||    |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  PS01053 ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       | |||          |  |        ||||||||| | ||  | || ||   |  |    ||| |    || || |  |             | |   | |         |   |    |  |      **^*^*****************               ||||    |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       | |||          |  |        ||||||||| | ||  | *****   |  |    ||| |    || || |  |             | |   | |         |   |    |  |        ||| |*****| |                      ||||    |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |   | | |||||    | ||||  || |||   | |              | |                   || |||       *****          |  |        ||||||||| | ||  | || ||   |  |    ||| |    || || |  |             | |   | |         |   |    |  |        ||| ||  | | |                      ||||    |  |||| | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |   | | |||||    | ||||  || |||   ***              | |                   || |||       ***|           |  |        ||||||||| | ||  | || ||   |  |    ||| |    || || |  |             | |   | |         |   |    |  |        *** ||  | | |                      ||||    |  |*** | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |   | | *****    ****||  |****|                    | |                   |****|       ****           |  |        ||||****| | |**** ****|   |  |    ||| |    ****| |  |             | |   | |         |   |    |  |         |  |**** | |                      ||||    |  | |  | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***   | | | |        ||||  |  | |                    | |                   |  | |                      |  |        ||||||| | | |      |  |   |  |    ||| |     |  | |  |             | |   | |         |   |    |  |         |  |     ***                      ||||    |  | |  | |   |              | || | 
search RasMol script viewer Motif-ligand binding stats  nest ..             | | ***        ****  |  ***                    ***                   |  ***                      |  |        ****||| | ***      |  |   |  |    *** |     |  | |  |             ***   | |         |   |    |  |         |  |                              ****    |  | |  | |   |              ***| | 
search RasMol script viewer Motif-ligand binding stats  niche ..             ***                  |    |                                          |    |                      ****         ***|**** | |      ****   ****     ****     **** ****                   | |         |   |    ****         ****                              |***    **** **** |   |                 | | 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                  ******                                          ******                                      | | | | |                                                           | |         |   |                                                   | |               |   |                 | | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                              ***** | |                                                           | |         |   |                                                   | |               *****                 | | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                              | | | | |                                                           | |         *****                                                   | |                                     | | 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                              *** *****                                                           ***                                                                 ***                                     *** 

   New search    4ixu:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors