triangle PDBeMotif: 4ixc  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.2
Classification transferase/transferase inhibitor    | release date: Fri, Jan 25, 2013
Title crystal structure of human glucokinase in complex with a sma molecule activator.
Authors D.HARGREAVES, D.J.OGG, S.GERHARDT
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search GLC GLC binding statistics GLC   search 1JD 1JD binding statistics 1JD   search NA NA binding statistics NA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSNSQVEQILAEFQLQAADLKKVMRRMQKEMDRGLRLETHAAASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLV
KVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTK
GFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNVELVEGDEG
RMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQLRTRGA
FETRFVSQVESDTGDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVD
GSVYKLHPSFKERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GLUCOKINASE ISOFORM 3
member of: GENE3D:searchG3DSA_3.30.420.40/searchG3DSA_3.40.367.20PANTHER:searchPTHR19443PFAM:searchPF00349/searchPF03727PRINTS:searchHEXOKINASEPROSITE PATTERNS:searchPS00378, SUPERFAMILY:searchSSF53067UniProt:searchP35557
JMol viewer RasMol script viewer  1JD 503A  ..                                                *** *****                         .. *                                                           *                                                  *   **                   *                                                                                                          ..1JD ..                                                                                                            **  *    
JMol viewer RasMol script viewer  GLC 502A  ..                                                ||| |||||                         .. |                                                   ***     |        **                                  **    |   ||         *   * *   |                    *                              *  *                                                   ..GLC ..                                                                                                            ||  |    
JMol viewer RasMol script viewer  NA 501A  ..                                                ||| |||||                         .. |                                                   |||     |        ||                                  ||    |   ||         |   | |   |  *  *  * *         |                              |  |                                                   ..NA ..                                                                                                            ||  |    
sec str:  ..hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeee........eeeeeeee...eeeeeeeeee......eeeeeeeeee.hhhhhh.hhhhhhhhhhhhhhhhhhhh......eeeeeee...eeeee..eeee...............hhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhh..eeeeeee...eeeeeeee.hhh........eeeee.hhhhh..........hhhhhhhhhh......hhhhhh.hhhhhhhhhhhhhhhhhh...hhhhh..hhhhh....hhhhhhhhhhh... ....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeeehhhhhhh.hhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhhhhh.
sequence :  ..NSQVEQILAEFQLQAADLKKVMRRMQKEMDRGLRLETHAAASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEG..QWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMGELVRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESD... ..GDRKQIYNILSTLGLRPSTTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFKERFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKK
seq num:  ..13        23        33        43        53        63        73        83          ..98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338 ... ..343       353       363       373       383       393       403       413       423       433       443       453    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || |   |  |                  |  |   |  |||| | | | |  ||    |       | |           ..  | |      |  |  || |   |              |||| |   |    |      |  ||   ^*** |  |||| ||           ||||        ^***      |  |  |  |    ||    |  |  ||  | | |      ||||||||||||| ||       |  | |  || ||| ||  ||          || ||||  |   ||  | |||  |  || || ..PS00001.. |||| ||  |||||  || |        |  |||                  |  |       |    ||  | | ||    ||| ||  |  |  |   || | |   |      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. || |   |  |                  |  |   |  |||| | | | |  ||    |       | |           ..  | |      |  |  || |   |              |||| |   |    |      |  ||    |   |  |||| ||           ||||         |        |  |  |  |    ||    |  |  ||  | | |      ||||||||||||| ||       |  | |  || ||| ||  ||          || ||||  |   ||  | |||  |  || || ..PS00004.. |||| ||  |||||  || |        |  |||                  |  |       |    ||  | | ||    ||**^*  |  |  |   || | |   |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || |   |  |                  |  |   |  |^** | | | |  ||    |       | |           ..  ^**      |  |  || |   |              |||| |   |    |      |  ||    |   |  |||| ||           ||||         |        |  |  |  |    ||    |  |  ||  | | |      ||||||||||||| ||       |  | |  || ||| ||  ||          || ||||  |   ||  | |||  |  || || ..PS00005.. |||| ||  |||||  || |        |  ^**                  |  |       |    ||  | ^**|    ^**  |  |  |  |   |^** |   |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***   |  |                  |  |   |  | || | | | ^***|    |       | |           ..           ^***  || |   |              |||| |   |    |      |  ||    |   |  ^*** ||           ||||         |        |  |  |  |    ||    |  |  ||  | | |      ||||||||||||| ||       |  | |  || ||| ||  ||          || ||||  |   ||  | |||  |  ^***| ..PS00006.. |||| ||  |||||  ^***        |   |                   ^***       |    ||  | ^***     |   |  |  ^***   |    |   |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***     |  |                  |  |   |  | || | | |     ^*****       | |           ..              |  || |   |              |||| |   |    |      |  |^*****   |   ^*****           ||||         |        |  |  |  ^*****^*****  |  ||  | | |      ||||||||||||| ||       |  | |  || ||| ||  ||          || ||||  |   ||  | ^*****  ||  | ..PS00008.. |||| ||  |||^*****          |   |                              ^*****|  |          |   |  |         ^*****   |      
search RasMol script viewer Motif-ligand binding stats  RGD ..        |  |                  |  |   |  | || | | |                  | |           ..              |  || |   |              |||| |   |    |      |  |         |   ||| |            ***|         |        |  |  |                |  ||  | | |      ||||||||||||| ||       |  | |  || ||| ||  ||          || ||||  |   ||  | |||     ||  | ..PS00016.. |||| ||  |||||              |   |                                    |  |          |   |  |              |   |      
search RasMol script viewer Motif-ligand binding stats  HEXOKINASES ..        |  |                  |  |   |  | || | | |                  | |           ..              |  || |   |              |||| |   **************************   ||| |            ||||         |        |  |  |                |  ||  | | |      ||||||||||||| ||       |  | |  || ||| ||  ||          || ||||  |   ||  | |||     ||  | ..PS00378.. |||| ||  |||||              |   |                                    |  |          |   |  |              |   |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |  |                  |  |   |  | || | | |                  | |           ..              ***** |   |              |||| |        |      |  |             ||| |            ||||         |        |  |  |                *****  | | |      |||||||||||*****       |  | |  || |*********          || ||||  |   ||  | |||     ||  | ..alphabetamotif.. |||| ||  |||||              |   |                                    |  |          |   |  |              |   |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..        |  |                  |  |   **** || | | |                  | |           ..              ****  |   |              |||| |        |      |  |             |****            ||||         |        |  ****                ****|  | | |      ||********|****|       **** ****| |********           |****|****   ||  ****|     |**** ..betaturn.. |||| ||  ****|              |   |                                    |  |          |   |  |              |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..        |  |                  |  |   |  | |*** ***                  | |           ..                    |   |              **** |        |      |  |             *** |            ****         |        |  |  |                    |  | | |      **** |******|  |       |  | |  |*** |  |              |  ****      ||  | ***     |   | ..nest.. **** ||  ||***              |   |                                    |  |          |   |  |              |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..        ****                  ****   ******    | |                  ***           ..                    |   |                ****        |      ****             *****                         |        *******                    **** ***      | ****      ****       **** ****    ****              |    |       |****         |   | ..niche..      ||  ||                 |   |                                    ****          |   ****              |   |      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                               | |                                ..                    |   |                            |                                                     |                                                 | |                       | |                         ******       |   |         |   | ..schellmannloop..      ||  ||                 |   |                                                  |   |                 |   |      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                               | |                                ..                    *****                            |                                                     |                                                 | |                       | |                                      |   |         |   | ..stmotif..      ||  ||                 |   |                                                  |   |                 |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                               | |                                ..                                                     |                                                     |                                                 | |                       | |                                      *****         ***** ..ststaple..      ******                 *****                                                  *****                 *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                               ***                                ..                                                     |                                                     |                                                 ***                       ***                                                          ..stturn..                                                                                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                  ..                                                     *                                                     *                                                                                                                                        ..REP00000..                                                                                                                     

   New search    4ixc:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors