triangle PDBeMotif: 4ims  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.14.13.39
Classification oxidoreductase/oxidoreductase inhibitor    | release date: Thu, Jan 3, 2013
Title structure of rat neuronal nitric oxide synthase heme domain with 6,6'-((5-(3-aminopropyl)-1,3-phenylene)bis(ethane-2,1- bis(4-methylpyridin-2-amine)
Authors H.LI, T.L.POULOS
Method X-RAY DIFFRACTION (resolution: 2.15Å)
PDBe Citation   
Small molecules:    search 12S 12S binding statistics 12S   search ZN ZN binding statistics ZN   search HEM HEM binding statistics HEM   search ACT ACT binding statistics ACT   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
CPRFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPSQHTRKPEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKA
HMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLR
SAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKAPRGRFDVLPLLLQANGNDPELFQI
PPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDL
DMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEML
NYRLTPSFEYQPDPWNTHVWKG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NITRIC OXIDE SYNTHASE, BRAIN
member of: GENE3D:searchG3DSA_3.90.1230.10/searchG3DSA_3.90.340.10PANTHER:searchPTHR19384/searchPTHR19384_SF49PFAM:searchPF02898PIRSF:searchPIRSF000333PROSITE PATTERNS:searchPS60001, SUPERFAMILY:searchSSF56512UniProt:searchP29476
JMol viewer RasMol script viewer  CL 805B  ..                                        ..                                                                                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  ZN 804B  ..                                        ..                                                                                                                                                                                                                                                                                                                                                      *                        
JMol viewer RasMol script viewer  12S 802B  ..                                        ..                                                                                                                                                                                                                                                                                                                                                      |                        
JMol viewer RasMol script viewer  CL 807A  ..                                        ..                                                                                                                                *                                                                                                             *       **                                                                                              |                        
JMol viewer RasMol script viewer  CL 806A  ..                                        ..                                                                                                                                |                                                                                                             |       *|  *                                                                                           |                        
JMol viewer RasMol script viewer  ZN 805A  ..                                        ..                                                                                                                                |                                                                                                             |       ||  *                                                                                           |                        
JMol viewer RasMol script viewer  ZN 804A  ..                           *    *       ..                                                                                                                                |                                                                                                             |       ||  |                                                                                           |                        
JMol viewer RasMol script viewer  ACT 803A  ..                           |    |       ..                                                                   *                                                            |                                                                                                            *|       ||  |                                                                                           |                        
JMol viewer RasMol script viewer  12S 802A  ..                           |    |    *  ..                                                                   |                                                            |  *                                                                                   * *                *  **   *   *|  |  *                                                                          *             |                        
JMol viewer RasMol script viewer  HEM 801A  ..                           |    |    |  ..                                                           *    ****                                                            |  |                                                                                   | |  *             ****|*  *   *|  |  |                                                                          *             |           * *          
sec str:  ....eeee......eeeehhhhhh.....................hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.....hhhhhhhheeee.....hhhhhhhhhhhhhhhhhhhhh...eeee...........ee.........eee.....eee...hhhhhhhhhhh.............eeee......eee..hhhhh.eee.....hhhhhhhh.eee...ee...eeee..eee....ee....hhhhhhhhhhh.....hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh....hhhhhh...hhhhh..............eee...hhhhh...
sequence :  ..RFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLP..TKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVW
seq num:  ..299       309       319       329       ..350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | || |      |  |  || || || |  |   ..         |      ||||||| |   |        |   | |   |     ||    | ^***| || || ||   ||| | |   |           | ||    |        |||||  | |          | ||||  | ||   |   | |||               |  |       |  |       |  |     | |  | |   | |     |    |     |  | |  |||  |  |||||      | || ||||||||              |||||||  |||||||   |     |  |||   | |  |   ||| | |  |               ||| ||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..      | || |      |  |  || || || |  |   ..         |      ||||||| |   |        |   | |   |     ||    |  | || || || ||   ||| | |   |           | ||    |        |||||  | |          | ||||  | ||   |   | |||               |  |       |  |       |  |     | |  | |   | |     |    |     |  | |  |||  |  |||||      | || **^*||||              |||||||  |||||||   |     |  |||   | |  |   ||| | |  |               ||| ||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | || |      |  |  || || || |  |   ..         |      ||^**|| |   |        |   | |   |     ||    |  | || || || ||   ||| | |   |           ^**|    |        |||||  | |          | ||||  | ||   |   | |||               |  |       |  |       |  |     | |  | |   | |     |    |     |  | |  |||  |  |||||      | ||  || ||||              ||^**||  |||||||   |     |  |||   | |  |   ||| | |  |               ||| ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | || |      |  ^***| || || |  |   ..         |      || |||| |   |        |   | |   |     ||    |  | || || || ||   ||| | |   |           | ||    |        |||||  | |          | |||^*** ||   |   | |||               |  |       |  |       |  |     | |  | |   | |     |    |     |  | |  |||  |  |||||      | ||  || ||||              || |||^***||^***   |     |  |||   | |  |   ||| | |  |               ||| ||  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      | || |      |  |   | || || |  |   ..         *******^| |||| |   |        |   | |   ******^|    |  | || || || ||   ||| | |   |           | ||    |        |||||  | |          | |||   | ||   |   | |||               |  |       |  |       |  |     | |  | |   | |     |    |     |  | |  |********^|||      | ||  || ||||              || |||   ||| ||    ******^  |||   | |  |   ||| | |  |               ||| ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | || |      |  |   | || || |  |   ..                 | |||| |   |        |   | |          ^*****  | || || || ||   ||| | |   |           | |^*****        |||||  | |          | |^***** ||   |   | |||               |  |       |  |       |  |     | |  | |   | |     ^*****     |  ^***** |  |  |||||      | ||  || ||||              || |||   ||| ||             |^***** |  |   ||| | |  |               ||| ||  
search RasMol script viewer Motif-ligand binding stats  NOS ..      | || |      |  |   | || || |  |   ..                 | |||| |   |        |   | |               |  | ******** ||   ||| | |   |           | ||             |||||  | |          | |||   | ||   |   | |||               |  |       |  |       |  |     | |  | |   | |                |    |    |  |  |||||      | ||  || ||||              || |||   ||| ||             | |     |  |   ||| | |  |               ||| ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | || |      |  |   | || || |  |   ..                 | |||| |   |        |   | |               |  |  | || || ||   ||| | |   |           | ||             |||||  | |          | |||   | ||   |   | |||               |  |       |  |       |  |     | |  | |   | |                |    |    |  |  |||||      | ||  || ||||              || |||   ||| ||             | |     |  |   ||| | |  |               |*****  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      | || |      |  |   | || || |  |   ..                 | |||| |   |        |   | |               |  |  | || || ||   ||| | |   |           | ||             |||||  | |          | |||   | ||   |   | |||               |  |       |  |       |  |     | |  | |   | |                |    |    |  |  |||||      | ||  || ||||              || |||   *****|             | |     |  |   ||| | |  |               ||| ||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..      ***| |      |  |   | || || |  |   ..                 | |||| |   |        |   | |               |  |  | || || ||   *** | |   |           | ||             ***||  | |          | |||   ***|   |   | |||               |  |       |  |       |  |     | |  | |   | |                |    |    |  |  |||||      | ||  || ||||              || |||   ***  |             | |     |  |   ||| | |  |               ||| ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |      ****   | || || |  |   ..                 ****|| |   |        |   | |               ****  | *******|    |  | |   |           ****             |||||  | |          ****|      |   |   ****|               ****       ****       |  |     | |  | |   | |                |    |    |  ****||||      | ||  |****||              |****|    |   |             | |     |  |   ||| | |  |               |****|  
search RasMol script viewer Motif-ligand binding stats  nest ..         ***      |  |   ***| || |  |   ..                   **** |   |        |   ***               |  |  |  |  |  |    |  | |   |           ***              ****|  | |            ***      |   |     ***                                     |  |     ***  | |   | |                |    |    |  |   ****      ***|  |  ****              |  ***    |   |             ***     |  |   *** | |  |               | | ||  
search RasMol script viewer Motif-ligand binding stats  niche ..         | |      ****   | |**** ****   ..                     ****   |        |   | |               *******  |  ****    **** |   |                             ****  ***                     |   |                                             ****          ***   ***                |    |    ****                ****                    |    |    |   |                     ****    **** ****               | ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..         | |             | || |         ..                        |   |        |   | |                     |  |               |   |                                                           |   |                                                                                    |    |                                                ******    |   |                                                     |   |   
search RasMol script viewer Motif-ligand binding stats  stmotif ..         | |             | || |         ..                        *****        |   | |                     |  |               *****                                                           |   |                                                                                    |    |                                                          |   |                                                     |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..         | |             | || |         ..                                     ***** |                     |  |                                                                               *****                                                                                    |    |                                                          *****                                                     *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..         ***             ******         ..                                         ***                     |  |                                                                                                                                                                        |    |                                                                                                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                        ..                                                                 *  *                                                                                                                                                                        *    *                                                                                                                            

chain B : NITRIC OXIDE SYNTHASE, BRAIN
member of: GENE3D:searchG3DSA_3.90.1230.10/searchG3DSA_3.90.340.10PANTHER:searchPTHR19384/searchPTHR19384_SF49PFAM:searchPF02898PIRSF:searchPIRSF000333PROSITE PATTERNS:searchPS60001, SUPERFAMILY:searchSSF56512UniProt:searchP29476
JMol viewer RasMol script viewer  CL 806B  ..                                        ..                                                                                                                                  *                                                                                                             *       **                                                                                                                         
JMol viewer RasMol script viewer  CL 805B  ..                                        ..                                                                                                                                  |                                                                                                             |       *|  *                                                                                                                      
JMol viewer RasMol script viewer  ZN 804B  ..                                        ..                                                                                                                                  |                                                                                                             |       ||  *                                                                                                                      
JMol viewer RasMol script viewer  ACT 803B  ..                                        ..                                                                                                                                  |                                                                                                            *|       ||  |                                                                                                                      
JMol viewer RasMol script viewer  12S 802B  ..                                     *  ..                                                                                                                                  *  *                                                                                   * *                ****|   *   **  |  *                                                                          *                                        
JMol viewer RasMol script viewer  HEM 801B  ..                                     |  ..                                                             *     ***                                       *                    |  |                                                                                   | |  *             ****|*  *   *|  |  |                                                                          *                         * *            
JMol viewer RasMol script viewer  CL 806A  ..                                     |  ..                                                             |     |||                                       |                    |  |                                                                                   | |  |             ||||||  |   ||  |  |                                                                          |             *           | |            
JMol viewer RasMol script viewer  ZN 805A  ..                                     |  ..                                                             |     |||                                       |                    |  |                                                                                   | |  |             ||||||  |   ||  |  |                                                                          |             *           | |            
JMol viewer RasMol script viewer  ZN 804A  ..                           *    *    |  ..                                                             |     |||                                       |                    |  |                                                                                   | |  |             ||||||  |   ||  |  |                                                                          |             |           | |            
JMol viewer RasMol script viewer  12S 802A  ..                           |    |    |  ..                                                             |     |||                                       |                    |  |                                                                                   | |  |             ||||||  |   ||  |  |                                                                          |            *|           | |            
sec str:  ....eeee......eeeehhhhhh......................hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.....hhhhh...eeee.....hhhhhhhhhhhhhhhhhhhhh...eeee...........ee.........eee.....eee...hhhhhhhhhhh.............eeee......eee..hhhhh.eee........hhhhh.eee...ee...eeee..eee....ee..eehhhhhhhhhhh.....hhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh...eehhhhhhhhhhhhhhhhhhhhh....hhhhhh...hhhhh..............eee...hhhhhh....
sequence :  ..RFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLP..VRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKG
seq num:  ..299       309       319       329       ..348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | |    | || |  || || || |  |   ..           |      ||||||| |   |        |   | |   |     ||    | ^***| || ||      ||| | |   |           | ||    |        |||||  | |          | ||||  | ||   |  || |||                          || ||      |  |  |  | |  | |   | |     |    |     |  | |  |||  |   ||||      | || ||||||||               ||||||  |||||||   |     |  |||   | |  |   ||| | |  |                 |  |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         | |    | || |  || || || |  |   ..           |      ||||||| |   |        |   | |   |     ||    |  | || || ||      ||| | |   |           | ||    |        |||||  | |          | ||||  | ||   |  || |||                          || ||      |  |  |  | |  | |   | |     |    |     |  | |  |||  |   ||||      | || **^*||||               ||||||  |||||||   |     |  |||   | |  |   ||| | |  |                 |  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | |    | || |  || || || |  |   ..           |      ||^**|| |   |        |   | |   |     ||    |  | || || ||      ||| | |   |           ^**|    |        |||||  | |          | ||||  | ||   |  || |||                          || ||      |  |  |  | |  | |   | |     |    |     |  | |  |||  |   ||||      | ||  || ||||               |^**||  |||||||   |     |  |||   | |  |   ||| | |  |                 |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | |    | || ^***| || || |  |   ..           |      || |||| |   |        |   | |   |     ||    |  | || || ||      ||| | |   |           | ||    |        |||||  | |          | |||^*** ||   |  || |||                          || ||      |  |  |  | |  | |   | |     |    |     |  | |  |||  |   ||||      | ||  || ||||               | |||^***||^***   |     |  |||   | |  |   ||| | |  |                 |  |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | |    | || |   | || || |  |   ..           *******^| |||| |   |        |   | |   ******^|    |  | || || ||      ||| | |   |           | ||    |        |||||  | |          | |||   | ||   |  || |||                          || ||      |  |  |  | |  | |   | |     |    |     |  | |  |********^|||      | ||  || ||||               | |||   ||| ||    ******^  |||   | |  |   ||| | |  |                 |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | |    | || |   | || || |  |   ..                   | |||| |   |        |   | |          ^*****  | || || ||      ||| | |   |           | |^*****        |||||  | |          | |^***** ||   |  || |||                          || ||      |  |  |  | |  | |   | |     ^*****     |  ^***** |  |   ||||      | ||  || ||||               | |||   ||| ||             |^***** |  |   ||| | |  |                 |  |    
search RasMol script viewer Motif-ligand binding stats  NOS ..         | |    | || |   | || || |  |   ..                   | |||| |   |        |   | |               |  | ********      ||| | |   |           | |              |||||  | |          | |||   | ||   |  || |||                          || ||      |  |  |  | |  | |   | |                |    |    |  |   ||||      | ||  || ||||               | |||   ||| ||             | |     |  |   ||| | |  |                 |  |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | |    | || |   | || || |  |   ..                   | |||| |   |        |   | |               |  |  | || |       ||| | |   |           | |              |||||  | |          | |||   | ||   |  || |||                          || ||      |  |  |  | |  | |   | |                |    |    |  |   ||||      | ||  || ||||               | |||   *****|             | |     |  |   ||| | |  |                 |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | |    | || |   | || || |  |   ..                   | |||| |   |        |   | |               |  |  | || |       *** | |   |           | |              ***||  | |          | ***   ***|   |  || |||                          || ||      |  |  |  | |  | |   | |                |    |    |  |   ||||      | ||  || ||||               | |||   ***  |             | |     |  |   ||| | |  |                 |  |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         | |    | || |   | || || |  |   ..                   | |||| |   |        |   | |               |  |  | || |        |  | |   |           | |              |||||  | |          *****      |   |  || |||                          || ||      |  |  |  | |  | |   | |                |    |    |  |   ||||      | ||  || ||||               | |||    |   |             | |     |  |   ||| | |  |                 |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |    **** |   | || || ****   ..                   ****|| |   |        |   | |               ****  | ****        |  | |   |           | |              |||||  | |          ****|      |   |  |****|                          ****|      |  |  **** |  | |   | |                |    |    |  |   ||||      | ||  |****||               ****|    |   |             | |     |  |   ||| | ****                 |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..         ***      |  |   ***| || |  |   ..                     **** |   |        |   ***               |  |  |  |          |  | |   |           ***              ****|  | |            ***      |   |  |  ***                           |  |      |  |     ***  | |   | |                |    |    |  |   ****      ***|  |  ****                 ***    |   |             ***     |  |   *** | |  |                 |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                  ****   | |**** ****   ..                       ****   |        |   |                 *******  |          **** |   |                             ****  ***                     |   |  |    |                           ****      ****          ***   ***                |    |    ****                ****  | |                         |   |                     ****    **** ****                 ****    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                         | || |         ..                          |   |        |   |                       |  |               |   |                                                           |   |  ******                                                                            |    |                              | |                         |   |                                                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                         | || |         ..                          *****        |   |                       |  |               *****                                                           |   |                                                                                    |    |                              | |                         |   |                                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         | || |         ..                                       *****                       |  |                                                                               *****                                                                                    |    |                              | |                         *****                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                         ******         ..                                                                   |  |                                                                                                                                                                        |    |                              ***                                                                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                        ..                                                                   *  *                                                                                                                                                                        *    *                                                                                                                              

   New search    4ims:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors