triangle PDBeMotif: 4iiq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification immune system    | release date: Thu, Dec 20, 2012
Title crystal structure of a human mait tcr in complex with bovine
Authors E.J.ADAMS, J.LOPEZ-SAGASETA
Method X-RAY DIFFRACTION (resolution: 2.86Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4
Modified residues:  search KFP KFP binding statistics KFP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAGQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKEL
QMKDSASYLCAVKDSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCV
LDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS
Chain B sequence:
MANAGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRL
ESAAPSQTSVYFCASSVWTGEGSGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVEL
SWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSA
EAWGRADSAAALE
Chain C sequence:
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCR
VKHVTLEQPRIVKWDRDLGGGGSGGSGSGGGGSRTHSLRYFRLGISEPGYGIPEFISAGYVDSHPITMYNSVSQLKEPRA
LWMEENLAPDHWERYTQLLRGWQQAFKVELKQLQHHYNHSGFHTYQRMIGCELLEDGSITGFLQYAYDGQDFLIFNKDTL
SWMAMDNVADIIRRVWEANRHELQYQKNWLEEECIAWLKRFLEYGKDALQRTEPPKVRVNHKETFPGITTLYCRAYGFYP
PEISINWMKNGEEIFQDTDYGGILPSGDGTYQTWVSVELDPQNGDIYSCHVEHGGVHMVLQGFQESETILGG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HUMAN MUCOSAL ASSOCIATED INVARIANT T CELL RECEPTOCHAIN;
member of: GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR19433/searchPTHR19433_SF5PFAM:searchPF07686/searchPF09291PROSITE PROFILES:searchPS50835, SMART:searchSM00406SUPERFAMILY:searchSSF48726UniProt:searchQ6P4G7
JMol viewer RasMol script viewer  SO4 301A  ..                                                         *                   * *                                                                                ..SO4 ..                                     
sec str:  ...eee...eeeee....eeeeeeee......eeeeee......eeeeee...eeeee..eeeeee....eeeeee...hhhhh.eeeeeee.....eee...eeeeee........eeee.........eeeeee...............eeee...ee..... ........eeeeee.........................
sequence :  ..QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVKDSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDM... ..MDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       ... ..165       175       185       195    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | || |    ^***             |  |                | |    |  |||         |  |        | | |                           |||| |    || ||  |^***| |  |  | |     ..PS00001..           |^***|   | |^*** |  |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | || |                     |  |                | |    |  |||         |  |        | | |                           |||^**    || ||  |    | |  |  ^**     ..PS00005..           ^**  |   | || |  |  |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         ^*** |                     |  |                | |    |  |||         |  |        | | |                           ||||      |^***  |    | |  |          ..PS00006..           | |  |   | || |  |  |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           |  |                     |  |                | |    ******         |  |        | | |                           ||||      |  ||  |    | |  |          ..betabulgeloop..           | |  |   | || |  |  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****                     ****                | |    |  |||         |  |        | | |                           ||||      |  ||  |    | |  |          ..betaturn..           | |  |   | || |  |  |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                    |  |                | |    |  |||         |  |        | ***                           ||||      |  ||  |    | |  |          ..gammaturn..           | |  |   | || |  |  |     
search RasMol script viewer Motif-ligand binding stats  nest ..                                    |  |                | |    |  ***         |  |        | |                             ****      |  ||  |    | |  |          ..nest..           | |  |   | || |  |  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ****                ***    |   |          ****        ***                                       ********    ******          ..niche..           ******   ******  ****     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                               *****                                                                            | |             ..stmotif..                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                ***             ..stturn..                                     

chain B : HUMAN MUCOSAL ASSOCIATED INVARIANT T CELL RECEPTOCHAIN;
member of: GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR23268/searchPTHR23268_SF4PFAM:searchPF07654PROSITE PROFILES:searchPS50835, SMART:searchSM00407SUPERFAMILY:searchSSF48726UniProt:searchP01850
JMol viewer RasMol script viewer  SO4 301B  ..                                                                                                                                                                     ***                                                                           
sec str:  ....eeee..eeeee....eeeeeee.....eeeeeee......eeeeeeee..eeee.......eeee.....eeeee...hhhhheeeeeeee..........ee...eeeeee.........eeeee..hhhhhhhhheeeeeeeeeee....eeeeeee..eee...eee....ee.........eeeeeeeeeehhhhh....eeeeeeee..................eeeeeeee...
sequence :  ..AGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSVWTGEGSGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | |    | ||   |     | | |      |  |       | || || |  ||| |^*** |  | | |    || ||         |  |  |      |   || | |  |          |||| | | |      |  | | |           ||| |         |  |^***   | |      |  |  |         | |  | | | |                
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     ^**    | ||   |     | | |      |  |       | || |^**  ||| |     |  | ^**    || ||         |  |  |      |   || | |  |          |||| | ^**      |  | | |           ||| |         |  |       ^**      |  |  |         | |  | | | |                
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            | ||   |     | | |      |  |       ^*** |     ||| |     |  |        || ||         |  |  |      |   ^*** |  |          ^*** | | |      |  | | |           ||| |         |  |                |  |  |         | ^*** | | |                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | ^*****     | | |      |  |         |  |     ||| |     |  |        || ||         |  |  |      ^*****   |  |          |||  | | |      |  | | |           ||| |         |  |                |  |  |         ^***** | | |                
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ****         | | |      |  |         ****     |****     |  |        ****|         |  |  |               |  |          |||  | | |      |  | | |           ||| |         |  |                |  |  |           |  | | | |                
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            |  |         | | |      |  |         |  |     ||| |     |  |         |  |         |  |  |               |  |          |||  | | |      |  | ***           ||| |         |  |                |  |  |           |  | | | |                
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |         *** |      |  |         |  |     ||| |     |  |         |  |         |  |  |               |  |          |||  | ***      |  |               ||| |         |  |                |  |  |           |  | | | |                
search RasMol script viewer Motif-ligand binding stats  niche ..            ****           ***      ****         ****     *****     ****         ****         *******               ****          |||  |          ****               *****         ****                *******           **** *****                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                  |*****                                                                                                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                  ***                                                                                                              

chain C : BETA-2-MICROGLOBULIN, MHC CLASS I-RELATED PROTEIN
member of: GENE3D:searchG3DSA_2.60.40.10/searchG3DSA_3.30.500.10PANTHER:searchPTHR16675/searchPTHR16675_SF53/searchPTHR19944/searchPTHR19944_SF16PFAM:searchPF00129/searchPF07654PRINTS:searchMHCCLASSIPROSITE PATTERNS:searchPS00290, PROSITE PROFILES:searchPS50835, SMART:searchSM00407SUPERFAMILY:searchSSF48726/searchSSF54452UniProt:searchC1ITJ8/searchP01888
JMol viewer RasMol script viewer  SO4 401C  ..                                                                                                ..                                                                                                                                                                                      * *    ..SO4 ..                                                   ..                        
sec str:  .......eeeeee...........eeeeeeee....eeeeeee..eee..ee...ee.....eeeeee..........eeeeeee......eeee.......eeeeeeeeee.........eeeeeee..eeeeeee......ee.hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeeeee.....eeeeeeeee..eeeeeee....eeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeee.... ...eeeeeeeee.....eeeeee..ee....ee....ee.....eeeeeeee........eeeeee....eeeeeee..
sequence :  ..IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDR..RTHSLRYFRLGISEPGYGIPEFISAGYVDSHPITMYNSVSQLKEPRALWMEENLAPDHWERYTQLLRGWQQAFKVELKQLQHHYNHSGFHTYQRMIGCELLEDGSITGFLQYAYDGQDFLIFNKDTLSWMAMDNVADIIRRVWEANRHELQYQKNWLEEECIAWLKRFLEYGKDALQRTEPPKVRVNHK... ..TTLYCRAYGFYPPEISINWMKNGEEIFQDTDYGGILPSGDGTYQTWVSVEL..QNGDIYSCHVEHGGVHMVLQGFQE
seq num:  ..1         11        21        31        41        51        61        71        81        91    ..114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294      ... ..309       319       329       339       349        ..362       372       382 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..               | |        |  | | |                       | |    |  |        ||||  |  |          ..  || |         | |         |  |        | |        |  |                             |^***              |||   |             |  |||                                              |  |           ..PS00001..           | |           ||| |   |   |||||   |     ..|  | | |   || |     ||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..               | |        |  | | |                       | |    |  |        |^**  |  |          ..  |^**         | |         |  |        | |        |  |                             | |                |||   |             |  |||                                              |  |           ..PS00005..           | |           ||| |   |   |||||   |     ..|  | | |   || |     ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..               | |        |  | | |                       | |    ^***        | |   |  |          ..  |            | |         |  |        | |        |  |                             | |                |||   |             |  |||                                              |  |           ..PS00006..           | |           ||| |   |   |||||   |     ..|  | | |   || |     ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..               | |        |  | | |                       | |                | |   |  |          ..***            | |         |  |        | |        |  |                             | |                |^*****             |  |||                                              |  |           ..PS00008..           | |           ||| |   ^*****|^*****     ..|  | | |   || |     ||  
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..               | |        |  | | |                       | |                **^****  |          ..               | |         |  |        | |        |  |                             | |                | |                 |  |||                                              |  |           ..PS00290..           | |           ||| |       |||||         ..|  | **^****| |     ||  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..               | |        |  | | |                       | |                      |  |          ..               | |         |  |        | |        |  |                             | |                | |                 *****|                                              |  |           ..asxmotif..           | |           ||| |       |||||         ..|  |        | |     ||  
search RasMol script viewer Motif-ligand binding stats  betabulge ..               | |        |  | | |                       | |                      |  |          ..               | |         |  |        | |        |  |                             | |                | |                    | |                                              |  |           ..betabulge..           | |           ||| |       |||||         ..|  |        | |     **  
search RasMol script viewer Motif-ligand binding stats  betaturn ..               | |        |  | | |                       | |                      |  |          ..               | |         ****        | |        |  |                             | |                | |                    | |                                              |  |           ..betaturn..           | |           ||| |       |||||         ..|  |        | |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               | |        |  | | |                       | |                      |  |          ..               | |                     ***        |  |                             | |                | |                    | |                                              |  |           ..gammaturn..           | |           ||| |       |||||         ..|  |        | |         
search RasMol script viewer Motif-ligand binding stats  nest ..               ***        |  | | |                       ***                      |  |          ..               ***                                |  |                             ***                ***                    ***                                              |  |           ..nest..           | |           ||| |       *****         ..|  |        ***         
search RasMol script viewer Motif-ligand binding stats  niche ..                          **** ***                                                ****          ..                                                  ****                                                                                                                        ****           ..niche..           ***           *****                     ..****                    

   New search    4iiq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors