triangle PDBeMotif: 4i03  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.24.65
Classification hydrolase/hydrolase inhibitor    | release date: Fri, Nov 16, 2012
Title human mmp12 in complex with a peg-linked bifunctional l-glut motif inhibitor
Authors E.A.STURA, E.CASSAR-LAJEUNESSE, L.DEVEL, L.VERA, V.DIVE
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search L88 L88 binding statistics L88   search PGO PGO binding statistics PGO   search DMS DMS binding statistics DMS   search PEG PEG binding statistics PEG   search GOL GOL binding statistics GOL   search CA CA binding statistics CA   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHA
FGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHAIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MACROPHAGE METALLOELASTASE
member of: GENE3D:searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF32PFAM:searchPF00413PIRSF:searchPIRSF001191PRINTS:searchMATRIXINSMART:searchSM00235SUPERFAMILY:searchSSF55486UniProt:searchP39900
JMol viewer RasMol script viewer  PEG 318A  ..                                        **                                                                                                                     
JMol viewer RasMol script viewer  EDO 317A  ..                                        ||                     *                           *                                                                   
JMol viewer RasMol script viewer  EDO 316A  ..                                        ||                     |                           |                         *     *                                   
JMol viewer RasMol script viewer  EDO 315A  ..                                        ||                     |      *                    |                         |     |                                   
JMol viewer RasMol script viewer  EDO 314A  ..                                        ||                     |      |                    |   *                     |     |                                   
JMol viewer RasMol script viewer  DMS 313A  ..                                        ||                     |      |                    |   |                     |     |        * *                        
JMol viewer RasMol script viewer  DMS 312A  ..                                        ||                     |   *  |       **           |   |                     |     |        | |                        
JMol viewer RasMol script viewer  PGO 311A  ..                                        ||                     |   |  |   *   ||           |   |                     |     |        | **                       
JMol viewer RasMol script viewer  PGO 310A  ..                                        ||                     |   |  |   |   ||           |   |                     |     |        | ||               *       
JMol viewer RasMol script viewer  GOL 309A  ..*                                       ||                     |   |  |   |   ||           |   |                     |  ***|        | ||               |    *  
JMol viewer RasMol script viewer  GOL 308A  ..** *                                    ||                     |   |  |   |   ||           |   |                     |  ||||        | ||               |   **  
JMol viewer RasMol script viewer  GOL 307A  ..|| |                **  *               ||                     |   |  |   |   ||           |   |   **                |  ||||        | ||               |   ||  
JMol viewer RasMol script viewer  L88 306A  ..|| |                ||  |               ||                     |   |  |   ****||           |   |   ||        *   *   *  |||*   **** *****              |   ||  
JMol viewer RasMol script viewer  CA 305A  ..|| |                ||  |               ||                     |   |  ** *|*||||           | * |*  ||        |   |   |  ||||   |||| |||||              |   ||  
JMol viewer RasMol script viewer  CA 304A  ..|| |               *||  |               ||                     |   |  || |||||||           | |*||  ||        |   |   |  ||||   |||| |||||              |   ||  
JMol viewer RasMol script viewer  CA 303A  ..|| |               |||  |               ||           *         |   |  || |||||||     * * * | ||||  ||        |   |   |  ||||   |||| |||||              |   ||  
JMol viewer RasMol script viewer  ZN 302A  ..|| |               |||  |               ||           |         * * |  || |||||*|     | | | * ||||  ||        |   |   |  ||||   |||| |||||              |   ||  
JMol viewer RasMol script viewer  ZN 301A  ..|| |               |||  |               ||           |         | | |  || |||||||     | | | | ||||  ||        |   *   *  |||*   |||| |||||              |   ||  
sec str:  ..........eeeeee.......hhhhhhhhhhhhhhhhhh....eeee.......eeeeee.................eee..........eeee....ee.....eehhhhhhhhhhhhh..........................hhhhhhhhhhhhh
sequence :  ..MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHAIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
seq num:  ..105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | | ^**    | ||               ||  | |                    | | |     |    |    | |||||   |  |  | | |          | || |||  |||  | || ^**  |||^** |  ||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |        | ||               ||  | |                    | | |     |    |    | |||||   |  |  | | |          | || |||  |||  | || |    ||| |  ^***|        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | |        | ||               ||  | |                    | | |     ^*****    ^*****|   |  |  | | |          | || |^*****|  | || |    ||| |  |   |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | |        | ||               ||  | |                    | ***                 ||| |   |  |  | | |          | || |||  | |  | || |    ||| |  |   |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |        | ||               ||  | |                    | |                   |****   |  |  | | |          | |****|  | |  **** |    ||| |  |   |        
search RasMol script viewer Motif-ligand binding stats  nest ..      | |        | ||               ||  | |                    ***                   ||| |   |  |  | | |          | |  ***  | |  | || |    ||| |  |   |        
search RasMol script viewer Motif-ligand binding stats  niche ..      ***        ****               |******                                          *****   ****  | ***          | |    |  ***********    *****  |   |        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 | |                |   |                                                          | |            | ******         |              |   |        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                 | |                |   |                                                          | |            |                |              *****        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 | |                *****                                                          | |            |                |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                 ***                                                                               ***            |                |                           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                  *                *                           

   New search    4i03:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML