triangle PDBeMotif: 4h76  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.24.65
Classification hydrolase/hydrolase inhibitor    | release date: Thu, Sep 20, 2012
Title crystal structure of the catalytic domain of human mmp12 in with a broad spectrum hydroxamate inhibitor
Authors A.ROSSELL, E.A.STURA, E.CASSAR-LAJEUNESSE, E.NUTI, L.VERA, V.DIVE
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search PGO PGO binding statistics PGO   search 10B 10B binding statistics 10B   search PEG PEG binding statistics PEG   search GOL GOL binding statistics GOL   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHA
FGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MACROPHAGE METALLOELASTASE
member of: GENE3D:searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF32PFAM:searchPF00413PIRSF:searchPIRSF001191PRINTS:searchMATRIXINSMART:searchSM00235SUPERFAMILY:searchSSF55486UniProt:searchP39900
JMol viewer RasMol script viewer  GOL 313A  ..   ****                                                                            *                                                                           
JMol viewer RasMol script viewer  PEG 312A  ..   ||||                 *                                                          |                **                                                         
JMol viewer RasMol script viewer  PEG 311A  ..   ||||                 |                                   ***                    |                ||                                                         
JMol viewer RasMol script viewer  PEG 310A  ..   ||||                 |                                   |||                    |                ||               *  * *                                    
JMol viewer RasMol script viewer  PGO 309A  ..   ||||                 |                                   |||                 ** |                ||               |  | |                                    
JMol viewer RasMol script viewer  PGO 308A  ..   ||||                 |                                   |||    *          ***| |                ||               |  | |                                    
JMol viewer RasMol script viewer  PGO 307A  ..   ||||                 |                                   |||    |          |||| |                ||               |  | |                            *  **   
JMol viewer RasMol script viewer  10B 306A  ..   ||||                 |                                   |||    |       ***|||| |                ||       **  **  *  | |*      * ****               |  ||   
JMol viewer RasMol script viewer  CA 305A  ..   ||||                 |                                   |||    |  ** * *|||||| |         *  *   ||       ||  ||  |  | ||      | ||||               |  ||   
JMol viewer RasMol script viewer  CA 304A  ..   ||||            *    |                                   |||    |  || | ||||||| |         |* |   ||       ||  ||  |  | ||      | ||||               |  ||   
JMol viewer RasMol script viewer  CA 303A  ..   ||||            |    |                            *      |||    |  || | ||||||| | * * *   || |   ||       ||  ||  |  | ||      | ||||               |  ||   
JMol viewer RasMol script viewer  ZN 302A  ..   ||||            |    |                            |      |||* * |  || | |||*||| | | | | * || |   ||       ||  ||  |  | ||      | ||||               |  ||   
JMol viewer RasMol script viewer  ZN 301A  ..   ||||            |    |                            |      |||| | |  || | ||||||| | | | | | || |   ||       ||  *|  *  | |*      | ||||               |  ||   
sec str:  ..........eeeeee.......hhhhhhhhhhhhhhhhhh....eeee.......eeeeee.................eee..........eeee....ee.....eehhhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
seq num:  ..105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | | ^**    | |||   |          ||  | |                    | | |     |    |    | |||||   |  |  | | |      |  || || |||  ||| ||||| ^**   | ^** |  ||   |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |        | |||   |          ||  | |                    | | |     |    |    | |||||   |  |  | | |      |  || || |||  ||| |||||       |  |  ^***|   |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | |        | |||   |          ||  | |                    | | |     ^*****    ^*****|   |  |  | | |      |  || || |^*****| |||||       |  |  |   |   |  | 
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..      | |        | |||   |          ||  | |                    | | |                 ||| |   |  |  | | |      ***^^**^**||  | | |||||       |  |  |   |   |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      | |        | ||*****          ||  | |                    | | |                 ||| |   |  |  | | |          | || |||  | *****||       |  |  |   |   |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | |        | ||               ||  | |                    | ***                 ||| |   |  |  | | |          | || |||  | ***| ||       |  |  |   |   |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |        | ||               ||  | |                    | |                   |****   |  |  | | |          | |****|  | **** ||       |  |  |   |   |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..      | |        | ||               ||  | |                    ***                   ||| |   |  |  | | |          | |  ***  | |  | ||       |  |  |   |   |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..      ***        ****               |******                                          *****   ****  | ***          | |    |  *********       ****  |   |   **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                 | |                |   |                                                          | |            | ******         |              |   |        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                 | |                |   |                                                          | |            |                |              *****        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                 | |                *****                                                          | |            |                |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                 ***                                                                               ***            |                |                           
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                  *                *                           

   New search    4h76:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors