triangle PDBeMotif: 4h3x  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.24.35
Classification hydrolase/hydrolase inhibitor    | release date: Fri, Sep 14, 2012
Title crystal structure of an mmp broad spectrum hydroxamate based cc27 in complex with the mmp-9 catalytic domain
Authors A.ROSSELL, E.A.STURA, E.CASSAR-LAJEUNESSE, E.NUTI, L.VERA, V.DIVE
Method X-RAY DIFFRACTION (resolution: 1.76Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search PGO PGO binding statistics PGO   search 10B 10B binding statistics 10B   search PEG PEG binding statistics PEG   search GOL GOL binding statistics GOL   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKD
GLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIR
HLYG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HUMAN MMP-9 CATALYTIC DOMAIN WILD-TYPE
member of: GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF30PFAM:searchPF00040/searchPF00413PFAMB:searchPB009869PRINTS:searchFNTYPEII/searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP14780
JMol viewer RasMol script viewer  PGO 310A  ..                                                                   **                                                                                               
JMol viewer RasMol script viewer  GOL 309A  ..                                                                   ||    *       *  *                                                                               
JMol viewer RasMol script viewer  GOL 308A  ..                                                                   ||   *|       |  |                                                                               
JMol viewer RasMol script viewer  GOL 307A  ..                                                                   ||   ||       |  |                                                               *               
JMol viewer RasMol script viewer  10B 306A  ..                                                                   ||   ||       ***|                               *   **  *     *      * ****     |               
JMol viewer RasMol script viewer  CA 305A  ..                                                           *       ||   ||       ||||      * * *                    |   ||  |     |      | ||||     |               
JMol viewer RasMol script viewer  CA 304A  ..                         *                                 |       ||   ||       ||||      | | |    * *             |   ||  |     |      | ||||     |               
JMol viewer RasMol script viewer  CA 303A  ..                         |                                 |       ||   ||  ** * *|||      | | |   *| |             |   ||  |     |      | ||||     |               
JMol viewer RasMol script viewer  ZN 302A  ..                         |                                 |       ||* *||  || | |||*      | | | * || |             |   ||  |     |      | ||||     |               
JMol viewer RasMol script viewer  ZN 301A  ..                         |                                 |       ||| |||  || | ||||      | | | | || |             |   *|  *     *      | ||||     |               
sec str:  ....ee..........eeeeee.......hhhhhhhhhhhhhhhhhhh...eeee.......eeeeee.................eee..........eeee....ee......eehhhhhhhhhhhhh.ee.....................hhhhhhhhhhhhh
sequence :  ..GFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
seq num:  ..106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |||     ^***   ^***||               ||  | |      | ||          |||||                 ||| |   |  | |    |   ||  |  || || |||  ||| ||  |     | || |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |||              | ||               ||  | |      | ||          |||||                 ||| |   |  | |    |   ||  |  || || |||  |^***|  |     | || |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |||              | ||               ||  | |      | ||          |||||                 ||| |   |  | |    ^*****  |  || || |^*****|  |  |     | || |             
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..    | |||              | ||               ||  | |      | ||          |||||                 ||| |   |  | |        |   ***^^**^**||  | |  |  |     | || |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |||              | ||               ||  | |      | ||          ||***                 ||| |   |  | |        |   |   | || |||  | |  |  |     | || |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|              | ||               ||  | |      | ||          |||||                 |****   |  | |        |   |   | |****|  | *******     | || |             
search RasMol script viewer Motif-ligand binding stats  nest ..      ***              | ||               ||  | |      | ||          *****                 ||| |   |  | |        |   |   | |  ***  | |  |  |     | || |             
search RasMol script viewer Motif-ligand binding stats  niche ..                       ****               |******      ****                                *****   **** |        |   |   | |    |  *********     ******             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                       | |                |   |        | |                                              |        |   |   | ******                | |                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                       | |                |   |        | |                                              |        *****   |                       | |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       | |                *****        | |                                              |                |                       | |                
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ***                             ***                                              |                |                       ***                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                        *                *                                          

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : HUMAN MMP-9 CATALYTIC DOMAIN WILD-TYPE
member of: GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF30PFAM:searchPF00040/searchPF00413PFAMB:searchPB009869PRINTS:searchFNTYPEII/searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP14780
JMol viewer RasMol script viewer  PEG 309B  ..                                                                         *                                                                                          
JMol viewer RasMol script viewer  GOL 307B  ..                                                                         |                                                                      **                  
JMol viewer RasMol script viewer  10B 306B  ..                                                                         |       ***                                *   **  *     *      * *****||                  
JMol viewer RasMol script viewer  CA 305B  ..                                                           *             |       |||       *   *                    |   ||  |     |      | |||||||                  
JMol viewer RasMol script viewer  CA 304B  ..                                                           |             |       |||       |   |    * *             |   ||  |     |      | |||||||                  
JMol viewer RasMol script viewer  CA 303B  ..                                                           |             |  ** * *||       |   |   **             |   ||  |     |      | |||||||                  
JMol viewer RasMol script viewer  ZN 302B  ..                                                           |         * * |  || | |||*      |   | * || |             |   ||  |     |      | |||||||                  
JMol viewer RasMol script viewer  ZN 301B  ..                                                           |         | | |  || | ||||      |   | | || |             |   *|  *     *      | |||||||                  
sec str:  ................eeeeee.......hhhhhhhhhhhhhhhhhh....eeee.......eeeeee.................eee..........eeee....ee......eehhhhhhhhhhhhhh.......................hhhhhhhhhhhhh
sequence :  ..GFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
seq num:  ..106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    |  |      ^***   ^***||               ||  | |      | ||          |||||                 ||| |   |  |      |    |  |  || || |||  ||| || || |   | || |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |  |               | ||               ||  | |      | ||          |||||                 ||| |   |  |      |    |  |  || || |||  |^***| || |   | || |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    |  |               | ||               ||  | |      | ||          |||||                 ||| |   |  |      ^*****  |  || || |^*****|  | || |   | || |             
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..    |  |               | ||               ||  | |      | ||          |||||                 ||| |   |  |              ***^^**^**||  | |  | || |   | || |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |  |               | ||               ||  | |      | ||          ||***                 ||| |   |  |                  | || |||  | |  | || |   | || |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****               | ||               ||  | |      | ||          |||||                 |****   |  |                  | |****|  | |  | || |   | || |             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       | ||               ||  | |      | ||          |||||                 ||| |   |  |                  | |  | |  | |  | |***   | || |             
search RasMol script viewer Motif-ligand binding stats  nest ..                       | ||               ||  | |      | ||          *****                 ||| |   |  |                  | |  ***  | |  | ||     | || |             
search RasMol script viewer Motif-ligand binding stats  niche ..                       ****               |******      ****                                *****   ****                  | |    |  *********     ******             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                       | |                |   |        | |                                                               | ******         |      | |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       | |                *****        | |                                                               |                |      | |                
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ***                             ***                                                               |                |      ***                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                *                         

   New search    4h3x:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors