triangle PDBeMotif: 4h1q  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.24.35
Classification hydrolase/hydrolase inhibitor    | release date: Tue, Sep 11, 2012
Title crystal structure of mutant mmp-9 catalytic domain in comple twin inhibitor.
Authors A.ROSSELLO, E.A.STURA, E.CASSAR-LAJEUNESSE, E.NUTI, L.VERA, M.P.CATALANI, V.D
Method X-RAY DIFFRACTION (resolution: 1.59Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search 0XX 0XX binding statistics 0XX   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLA
HAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-9
member of: GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF30PFAM:searchPF00040/searchPF00413PFAMB:searchPB009869PRINTS:searchFNTYPEII/searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP14780
JMol viewer RasMol script viewer  0XX 307A  ..                                                                     ****    *******                            **  **  *     *      * ****                     
JMol viewer RasMol script viewer  CA 306A  ..                                       *  * *                        ||||    |||||||                            ||  ||  |     |      | ||||                     
JMol viewer RasMol script viewer  CA 305A  ..                                       |  | |                        |||** * *||||||           *  *             ||  ||  |     |      | ||||                     
JMol viewer RasMol script viewer  CA 304A  ..                     *                 |  | |                        ||||| | |||||||           |* *             ||  ||  |     |      | ||||                     
JMol viewer RasMol script viewer  CA 303A  ..                     |                 |  | |          *             ||||| | |||||||   * * *   || |             ||  ||  |     |      | ||||                     
JMol viewer RasMol script viewer  ZN 302A  ..                     |                 |  | |          |         * * ||||| | |||*|||   | | | * || |             ||  ||  |     |      | ||||                     
JMol viewer RasMol script viewer  ZN 301A  ..                     |                 |  | |          |         | | ||||| | |||||||   | | | | || |             ||  *|  *     *      | ||||                     
sec str:  ............eeeeee.......hhhhhhhhhhhhhhhhhh....eeee.......eeeeee.................eee..........eeee....ee......eehhhhhhhhhhhhh........................hhhhhhhhhhhhh
sequence :  ..FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
seq num:  ..110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          ^***   ^***||                |  | |      | ||          | | |                 ||| |   |  |  |||||    |      | || |||  ||| || ||     | || |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                   | ||                |  | |      | ||          | | |                 ||| |   |  |  |||||    |      | || |||  |^***| ||     | || |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                   | ||                |  | |      | ||          | | |                 ||| |   |  |  ||||^*****      | || |^*****|  | ||     | || |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..                   | ||                |  | |      | ||          | ***                 ||| |   |  |  ||||            | || |||  | |  | ||     | || |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | ||                |  | |      | ||          | |                   |****   |  |  ||||            | |****|  | *******     | || |             
search RasMol script viewer Motif-ligand binding stats  nest ..                   | ||                |  | |      | ||          ***                   ||| |   |  |  |***            | |  ***  | |  | ||     | || |             
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****                ******      ****                                *****   ****  | |             | |    |  *********     | |***             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   | |                             | |                                               | |             | ******  | |    |      | |                
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ***                             ***                                               ***             |         ***    |      ***                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                     *                *                         

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : MATRIX METALLOPROTEINASE-9
member of: GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF30PFAM:searchPF00040/searchPF00413PFAMB:searchPB009869PRINTS:searchFNTYPEII/searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP14780
JMol viewer RasMol script viewer  0XX 306B  ..  *                                                                          ***** *                            *   **  *  ****      * ****                 *   
JMol viewer RasMol script viewer  CA 305B  ..  |                                                                     ** * *|||| |           *  *             |   ||  |  ||||      | ||||                 |   
JMol viewer RasMol script viewer  CA 304B  ..  |                  *                                                  || | ||||| |           |* *             |   ||  |  ||||      | ||||                 |   
JMol viewer RasMol script viewer  CA 303B  ..  |                  |                                 *                || | ||||| |   * * *   || |             |   ||  |  ||||      | ||||                 |   
JMol viewer RasMol script viewer  ZN 302B  ..  |                  |                                 |         * *    || | |||*| |   | | | * || |             |   ||  |  ||||      | ||||                 |   
JMol viewer RasMol script viewer  ZN 301B  ..  |                  |                                 |         | |    || | ||||| |   | | | | || |             |   *|  *  |||*      | ||||                 |   
sec str:  ............eeeeee.......hhhhhhhhhhhhhhhhhh....eeeee......eeeeee.................eee..........eeee....ee......eehhhhhhhhhhhhh........................hhhhhhhhhhhhh
sequence :  ..FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG
seq num:  ..110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          ^***   ^***||                |  | |      | ||          |||||                 ||| |   |  |  | | |    |      | || |||  ||| || ||     | || |             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                   | ||                |  | |      | ||          |||||                 ||| |   |  |  | | |    |      | || |||  |^***| ||     | || |             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                   | ||                |  | |      | ||          |||||                 ||| |   |  |  | | ^*****      | || |^*****|  | ||     | || |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..                   | ||                |  | |      | ||          ||***                 ||| |   |  |  | |             | || |||  | |  | ||     | || |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | ||                |  | |      | ||          |||||                 |****   |  |  | |             | |****|  | *******     | || |             
search RasMol script viewer Motif-ligand binding stats  nest ..                   | ||                |  | |      | ||          *****                 ||| |   |  |  | |             | |  ***  | |  | ||     | || |             
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****                ******      ****                                *****   ****  | |             | |    |  *********     | |***             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   | |                             | |                                               | |             | ******  | |    |      | |                
search RasMol script viewer Motif-ligand binding stats  stturn ..                   ***                             ***                                               ***             |         ***    |      ***                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                     *                *                         

   New search    4h1q:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors