triangle PDBeMotif: 4g0w  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   5.99.1.3
Classification isomerase/dna/isomerase inhibitor    | release date: Tue, Jul 10, 2012
Title human topoisomerase iibeta in complex with dna and ametantro
Authors C.C.WU, N.L.CHAN, T.K.LI, Y.C.LI
Method X-RAY DIFFRACTION (resolution: 2.70Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search AKE AKE binding statistics AKE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MASWSHPQFEKGADDDDKVPDPTSVDSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYG
VFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWP
SLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAG
PEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGF
KPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAAS
PRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDG
LDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHT
DTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLG
AESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEDETQNQHDDSSSDSGTPSGPDF
NYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVESQEREDGAPGFSSISAHHHHHHH
HHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA TOPOISOMERASE 2-BETA
member of: GENE3D:searchG3DSA_1.10.268.10/searchG3DSA_3.30.1360.40/searchG3DSA_3.30.1490.30/searchG3DSA_3.30.230.10/searchG3DSA_3.40.50.670/searchG3DSA_3.90.199.10PANTHER:searchPTHR10169/searchPTHR10169_SF18PFAM:searchPF00204/searchPF00521/searchPF01751PRINTS:searchTOPISMRASEII/searchTPI2FAMILYPROSITE PATTERNS:searchPS00177, PROSITE PROFILES:searchPS50880, SMART:searchSM00433/searchSM00434SUPERFAMILY:searchSSF54211/searchSSF56719UniProt:searchQ02880
JMol viewer RasMol script viewer  MG 102F  ..                                                                                                                                            ..                                                    ..MG ..                                                                                                                                                                                                                                                                                                                                                                                                                     ..MG ..                                                                   
JMol viewer RasMol script viewer  AKE 101F  ..                                                   * **             * *                                                                     ..                                                    ..AKE ..                                                                       *   *                                                                                                                                                                                                                                                                                                                                         ..AKE ..                                                                   
JMol viewer RasMol script viewer  MG 1302A  ..                                                   | ||             | |                                                                     ..                                                    ..MG ..                                                                       |   |                                                                                                                                                                                                                                                                                                                                         ..MG ..                                                                   
JMol viewer RasMol script viewer  MG 1301A  ..                                                   | ||             | |                                  * *                                ..                                                    ..MG ..                                                                       |   |                                                                                                                                                                                                                                                                                                                                         ..MG ..                                                                   
sec str:  .................hhhh.eeeeeehhhhhhhhhhhhhhhhhh.eeeeee.....hhhhhhhhhhhhhhhhhhhhhhhh...........hhhhh...eeeee...hhhhhhhhhhhhhhhhhhhhhhhhh..eeee.....hhhhheeeee...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..... ...eeehhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh....eehhhhhhhhhhhh....hhhhhhhhhhhhhh.................................ee....hhhhhhhhhhhhhh.eee....eeee.......hhhhhh..eee....eee....hhhhhhhhhhhhhh................eeeeee..eeeee.eeeeee..eeeeee.....hhhhhhhhhhhhhhhh.........eeee........eeee.hhhhhhhhhhhhhhhhh..eeeee....eee.....eee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh....hhhhhhhhh..... .....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..KGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFIT..ADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGL... ..KHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQE... ..GPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVESQERED
seq num:  ..452       462       472       482       492       502       512       522       532       542       552       562       572       582       ..645       655       665       675       685         ... ..707       717       727       737       747       757       767       777       787       797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977       987       997       1007      1017      1027      1037      1047      1057      1067      1077      1087      1097      1107 ... ..1135      1145      1155      1165      1175      1185      1195   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |  |  ||   || |   ||  || ||          |  |          ||| || | |  |         | ||| ||  |  ||||||       |  |   |   |    |          ||||     ..   |  |          |   ||  | |||   |   |              ..PS00001..   |  ||        |  | || | | || |             | |           |  | | ||           |  |              |    | ||| ||||||||    |  |     | || ||                        | | |    |       |   |     |  | |        |  |  |  | |  |          | ||      |  |              ^***||           | || |             |  |    ||||      | |    | |     |  ||                    |    || |            |||||||^***|||    | |||  | | |      ..PS00001..  ||  ||^***|| |                    || ||  ||                      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  |  |  ||   || |   ||  || ||          |  |          ||| || | |  |         | ||| ||  |  ||||||       |  |   |   |    |          ||||     ..   |  |          |   ||  | |||   |   |              ..PS00004..   |  ||        |  | || | | || |             | |           |  | | ||           |  |              |    | ||| ||||||||    |  |     | || ||                        | | |    |       |   |     |  | |        |  |  |  | |  |          | ||      |  |                | ||           | || |             |  |    ||||      | |    | |     |  ||                    |    || |            ||||||| || |||    | |||  | | |      ..PS00004..  ||  || || || |                    |**^*  ||                      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |  |  ||   || |   ||  |^**|          |  |          ||| |^** |  |         | ||| ||  |  ^**^**       |  |   |   |    |          ||||     ..   |  |          |   ||  ^**||   |   |              ..PS00005..   |  ||        |  | || | | || |             | |           |  | | ||           |  |              |    | ||| |||^**||    |  |     | || ||                        | | |    |       |   |     |  | |        |  |  |  | |  |          | ||      |  |                ^**|           | |^**             |  |    ||||      | |    | |     |  ||                    |    |^**            ||||||| |^**||    | |||  | | |      ..PS00005..  ||  || || || |                    |  ||  ||                      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |  |  ||   || |   |^***   |          |  |          ||| |    |  |         | ||| |^***  || ||        ^***   |   |    |          ||||     ..   |  |          |   ||  | |||   |   |              ..PS00006..   ^***|        ^*** || | ^*** |             | |           ^*** | ||           |  |              |    | ||| ||||||||    |  |     | || ||                        | | |    |       |   |     |  | |        |  |  ^*** |  |          | ||      |  |                |  |           | ||               |  |    ||||      | |    | |     ^***|                    |    |               ||||||| |^***|    | |||  | | |      ..PS00006..***|  || || || |                    |  |^***|                      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |  |  ||   || |   |       |          |  |          ||| |    |  |         | ||| |      || ||           |   |   |    |          ||||     ..   |  |          |   ||  | |||   |   |              ..PS00007..   |   |             || | | || |             | |                | ||           |  |              |    | ||| ||||||||    |  |     | || ||                        | | |    |       |   |     |  | |        |  |       |  |          | ||      |  |                |  |           | ||               |  |    ||||      | |    | |     |   |                    |    |               ||||||| ||   |    | |||  | | |      ..PS00007..   |  || || || |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |  |  |^***** |   |       |          |  |          ||| |    |  |         | ||| |      || ||           |   |   ^*****          ||||     ..   |  |          |   ||  | |||   |   |              ..PS00008..   |   |             || | | || |             | |                | ||           |  |              ^***** |^*****|||||    |  |     | || ||                        | | ^*****       |   |     |  | |        |  |       |  |          | ||      |  |                |  |           | ||               |  |    ||||      | |    | |     |   |                    ^*****               ||||||| ||   |    | |||  | | |      ..PS00008..   |  || || || |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  TOPOISOMERASE_II ..  |  |  |  |    |  |   *********          |  |          ||| |    |  |         | ||| |      || ||           |   |                   ||||     ..   |  |          |   ||  | |||   |   |              ..PS00177..   |   |             || | | || |             | |                | ||           |  |                     | | || |||||    |  |     | || ||                        | |              |   |     |  | |        |  |       |  |          | ||      |  |                |  |           | ||               |  |    ||||      | |    | |     |   |                                         ||||||| ||   |    | |||  | | |      ..PS00177..   |  || || || |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |  |  |    |  |                      |  |          ||| |    |  |         | ||| |      || ||           |   |                   ||||     ..   |  |          |   ||  | |||   |   |              ..alphabetamotif..   |   |             || | | || |             | |                | ||           |  |                     | | || |||||    |  |     | || ||                        | |              |   |     |  | |        |  |       |  |          | ||      |  |                |  |           | ||               |  |    ||||      | |    | |     |   |                                         ||||||| ||   |    | |||  | | |      ..alphabetamotif..   ***** || || |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |  |  |    |  |                      |  |          ||| |    |  |         | ||| |      || ||           *****                   ||||     ..   |  |          |   ||  | |||   |   |              ..asxmotif..   |   |             || | | || |             | |                | ||           |  |                     | | || |||||    |  |     | || ||                        | |              *****     |  | |        |  |       |  |          | ||      |  |                |  |           | ||               |  |    ||||      | |    | |     |   |                                         ||||||| ||   |    | |||  *****      ..asxmotif..   |  |  || || |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |  |  |    |  |                      |  |          *** |    |  |         | ||| |      || ||           |   |                   ||||     ..   |  |          |   ||  | |||   |   |              ..asxturn..   |   |             || | | || |             | |                | ||           |  |                     | | || |||||    |  |     | || ||                        | |                        |  | |        |  |       |  |          ***|      |  |                |  |           | ||               |  |    ||||      | |    | |     |   |                                         ||||||| ||   |    | |||  ***        ..asxturn..   |  |  || || |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |  |  |    ****                      |  |           |  |    |  |         | ||| |      ****|           |   |                   ||||     ..   |  |          |   ||  ****|   |   |              ..betaturn..   |   |             || | | || |             | |                | ||           |  |                     | | || ****|    ****     ******|                        | |                        **** |        |  |       |  |          |  |      ****                |  |           | ||               ****    ||||      | |    | |     |   |                                         ||||||| ||   |    ****|             ..betaturn..   ****  |******                    ****|   |                      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |  |  |    |  |                      |  |           |  |    |  |         | ||***       |  |           |   |                   ||||     ..   |  |          |   ||  | | |   |   |              ..gammaturn..   |   |             || | | || |             | |                | ||           |  |                     | | || |||||                |  |                        | |                           | |        |  |       |  |          |  |      |  |                |  |           | ||                       ||||      ***    | |     |   |                                         ||||||| ||   |      | |             ..gammaturn..      |  |  |  |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |  |  |    |  |                      |  |           |  |    |  |         ***|  |       |  |           |   |                   ****     ..   |  |          |   ||  | | |   |   |              ..nest..   |   |             || | | |***             ***                ***|           |  |                     *****| |||||                |  |                        ***                           ***        |  |       |  |          |  |      |  |                |  |           | ||                       ****             ***     |   |                                         ****||| ||   |      ***             ..nest..      |  |  |  |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  niche ..  ****  ****    ****                      ****           ****    ****            ****       ****           |   |                    ***     ..   ****          |   |**** | |   |   |              ..niche..   |   |             **** | |                                      |           ****                       **** |****                ****                                                                 ****       ****          ****      ****                ****           ****                                                |   |                                             *****|   |                      ..niche..      ****  ****                    ****|   |                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                           |   |                            ..                 |   |   *****   |   |              ..stmotif..   *****              |   | |                                      |                                           *****                                                                                                                                                           | |                                                 *****                                                  *****                      ..stmotif..                                        *****                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                           *****                            ..                 *****   | |     *****              ..ststaple..                      |   | |                                      |                                           | ||                                                                                                                                                            | |                                                                                                                                   ..ststaple..                                                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                            ..                         ***                        ..stturn..                      |   ***                                      |                                           ***|                                                                                                                                                            ***                                                                                                                                   ..stturn..                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                            ..                                                    ..REP00000..                      *                                            *                                              *                                                                                                                                                                                                                                                                                                  ..REP00000..                                                                   

chain B : DNA TOPOISOMERASE 2-BETA
member of: GENE3D:searchG3DSA_1.10.268.10/searchG3DSA_3.30.1360.40/searchG3DSA_3.30.1490.30/searchG3DSA_3.30.230.10/searchG3DSA_3.40.50.670/searchG3DSA_3.90.199.10PANTHER:searchPTHR10169/searchPTHR10169_SF18PFAM:searchPF00204/searchPF00521/searchPF01751PRINTS:searchTOPISMRASEII/searchTPI2FAMILYPROSITE PATTERNS:searchPS00177, PROSITE PROFILES:searchPS50880, SMART:searchSM00433/searchSM00434SUPERFAMILY:searchSSF54211/searchSSF56719UniProt:searchQ02880
JMol viewer RasMol script viewer  MG 102D  ..                                                                                                                                                ..                                                    ..MG ..                                                                                                                                                                                                                                                                 ..MG ..                                                                                                                                                ..                                                                   
JMol viewer RasMol script viewer  AKE 101D  ..                                                      ***              * *                                                                      ..                                                    ..AKE ..                                                                        *   *                                                                                                                                                                                    ..AKE ..                                                                                                                                                ..                                                                   
JMol viewer RasMol script viewer  MG 1302B  ..                                                      |||              | |                                                                      ..                                                    ..MG ..                                                                        |   |                                                                                                                                                                                    ..MG ..                                                                                                                                                ..                                                                   
JMol viewer RasMol script viewer  MG 1301B  ..                                                      |||              | |                                  * *                                 ..                                                    ..MG ..                                                                        |   |                                                                                                                                                                                    ..MG ..                                                                                                                                                ..                                                                   
sec str:  ....................hhhh.eeeeeehhhhhhhhhhhhh.hhhh.eeeeee..........hhhhhhhhhhhhhhhhhhh..........hhhhhh...eeeee...hhhhhhhhhhhhhhhhhhhhhhhhh..eeee.......hhhh.eeeee..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.... ....eeehhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh....eehhhhhhhhhhhhh...hhhhhhhhhhhhhh.................................ee....hhhhhhhhhhhhhh.eee....eeee.......hhhhhh..eee....eee....hhhhhhhhhhhhhh................eeeeee..eeeee.eeeeee..eeeeee.....hhhhhhhhhhhhhhh.... .......eeee........eeee.hhhhhhhhhhhhhhhhh..eeeee...eeee.....eeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh....hhhhhhhhh......hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..SKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITP..FADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHG... ..TKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNG... ..PALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQ..GPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVESQERED
seq num:  ..449       459       469       479       489       499       509       519       529       539       549       559       569       579       589 ..644       654       664       674       684         ... ..706       716       726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916       926       936       946       956    ... ..967       977       987       997       1007      1017      1027      1037      1047      1057      1067      1077      1087      1097          ..1135      1145      1155      1165      1175      1185      1195   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |  |  |  ||   || |   ||  || ||   |  |   |  |          | |  | | |  |         | ||  ||  | |||||||       |  |   |   |    |    || || ||||      ..    |  |      |  |     |  | |                       ..PS00001..    |  |     |  ||  | || | | || |             | |           || | | ||           |  | |  |         |    | ||| ||||||||    |  |     | || ||                    |  || | |    |       |   |      | |||        |  |  |  | |  |          | ||      |  |         |  ||^*..PS00001..    ||     | || |           || ||  || ||||           | |||     |  ||                    |    || |            |||||||^***||     | |||  |   |     ..  ||| ||^***|  |                    || ||  ||                      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |  |  |  ||   || |   ||  || ||   |  |   |  |          | |  | | |  |         | ||  ||  | |||||||       |  |   |   |    |    || || ||||      ..    |  |      |  |     |  | |                       ..PS00004..    |  |     |  ||  | || | | || |             | |           || | | ||           |  | |  |         |    | ||| ||||||||    |  |     | || ||                    |  || | |    |       |   |      | |||        |  |  |  | |  |          | ||      |  |         |  ||  ..PS00004..    ||     | || |           || ||  || ||||           | |||     |  ||                    |    || |            ||||||| || ||     | |||  |   |     ..  ||| || |  |  |                    |**^*  ||                      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |  |  ||   || |   ||  |^**|   |  |   |  |          | |  ^** |  |         | ||  ||  | |^**^**       |  |   |   |    |    || || ||||      ..    |  |      |  |     |  ^**                       ..PS00005..    |  |     |  ||  | || | | || |             | |           || | | ||           |  | |  |         |    | ||| |||^**||    |  |     | || ||                    |  || | |    |       |   |      | |||        |  |  |  | |  |          | ||      |  |         |  ||  ..PS00005..    ||     | |^**           || ||  || ||||           | |||     |  ||                    |    |^**            ||||||| |^**|     | |||  |   |     ..  ||| || |  |  |                    |  ||  ||                      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |  |  ||   || |   |^***   |   |  |   |  |          | |      |  |         | ||  |^*** | || |        ^***   |   |    |    || || ||||      ..    |  |      |  |     |  | |                       ..PS00006..    ^***     |  |^*** || | ^*** |             | |           ^*** | ||           |  | |  |         |    | ||| ||| | ||    |  |     | || ||                    |  || | |    |       |   |      | |||        |  |  ^*** |  |          | ||      |  |         |  ||  ..PS00006..    ||     | ||             || ||  || ||||           | |||     ^***|                    |    |               ||||||| |^***     | |||  |   |     ..***|| || |  |  |                    |  |^***|                      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |  |  ||   || |   |       |   |  |   |  |          | |      |  |         | ||  |   | | || |           |   |   |    |    || || ||||      ..    |  |      |  |     |  | |                       ..PS00007..             |  ||    || | | || |             | |            |   | ||           |  | |  |         |    | ||| ||| | ||    |  |     | || ||                    |  || | |    |       |   |      | |||        |  |       |  |          | ||      |  |         |  ||  ..PS00007..    ||     | ||             || ||  || ||||           | |||     |   |                    |    |               ||||||| |         | |||  |   |     ..  ||| || |  |  |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |  |  |^***** |   |       |   |  |   |  |          | |      |  |         | ||  |   | | || |           |   |   ^*****    || || ||||      ..    |  |      |  |     |  | |                       ..PS00008..             |  ||    || | | || |             | |            |   | ||           |  | |  |         ^***** |^***** | ||    |  |     | || ||                    |  || | ^*****       |   |      | |||        |  |       |  |          | ||      |  |         |  ||  ..PS00008..    ||     | ||             || ||  || ||||           | |||     |   |                    ^*****               ||||||| |         | |||  |   |     ..  ||| || |  |  |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  TOPOISOMERASE_II ..     |  |  |  |    |  |   *********   |  |   |  |          | |      |  |         | ||  |   | | || |           |   |             || || ||||      ..    |  |      |  |     |  | |                       ..PS00177..             |  ||    || | | || |             | |            |   | ||           |  | |  |                | | ||  | ||    |  |     | || ||                    |  || |              |   |      | |||        |  |       |  |          | ||      |  |         |  ||  ..PS00177..    ||     | ||             || ||  || ||||           | |||     |   |                                         ||||||| |         | |||  |   |     ..  ||| || |  |  |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |  |  |    |  |               |  |   |  |          | |      |  |         | ||  |   | | || |           |   |             || || ||||      ..    |  |      |  |     |  | |                       ..alphabetamotif..             *****    || | | || |             | |            |   | ||           |  | |  |                | | ||  | ||    |  |     | || ||                    |  || |              |   |      | |||        |  |       |  |          | ||      |  |         *****  ..alphabetamotif..    ||     | ||             *****  || ||||           | |||     |   |                                         ||||||| |         | |||  |   |     ..  |***** |  |  |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     |  |  |  |    |  |               |  |   |  |          | |      |  |         | ||  |   | | || |           *****             || || ||||      ..    |  |      |  |     |  | |                       ..asxmotif..             |  |     || | | || |             | |            |   | ||           |  | |  |                | | ||  | ||    |  |     | || ||                    |  || |              *****      | |||        |  |       |  |          | ||      |  |         |  |   ..asxmotif..    ||     | ||             || ||  || ||||           | |||     |   |                                         ||||||| |         | |||  *****     ..  ||| |  |  |  |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |  |  |    |  |               |  |   |  |          | |      |  |         | ||  |   *** || |                             || || ||||      ..    |  |      |  |     |  | |                       ..asxturn..             |  |     || | | |***             | |            |   | ||           |  | |  |                | | ||  | ||    |  |     | || ||                    |  || |                         | |||        |  |       |  |          ***|      |  |         |  |   ..asxturn..    ||     | ||             || ||  || ||||           | |||     |   |                                         ||||||| |         | |||            ..  *** |  |  |  |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  betabulge ..     |  |  |  |    |  |               |  |   |  |          | |      |  |         | ||  |     | || |                             || || ||||      ..    |  |      |  |     |  | |                       ..betabulge..             |  |     || | | || |             | |            |   | ||           |  | |  |                | | ||  | ||    |  |     | || ||                    |  || |                         | |||        |  |       |  |          |  |      |  |         |  |   ..betabulge..    **     | ||             || ||  || ||||           | |||     |   |                                         ||||||| |         | |||            ..   |  |  |  |  |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..     |  |  |  |    |  |               |  |   |  |          | |      |  |         | ||  |     | || |                             || || ||||      ..    |  |      |  |     |  | |                       ..betabulgeloop..             |  |     || | | || |             | |            |   | ||           |  | |  |                | | ||  | ||    |  |     | || ||                    |  || |                         | |||        |  |       |  |          |  |      |  |         |  |   ..betabulgeloop..           | ||             || ||  || ||||           *****     |   |                                         ||||||| |         | |||            ..   |  |  |  |  |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |  ****    ****               ****   |  |          | |      |  |         | ||  |     **** |                             ***** ||||      ..    |  |      ****     |  | |                       ..betaturn..             ****     || | | || |             | |            |   | ||           |  | ****                | | ||  | ||    ****     ******|                    ****| |                         ****|        ****       |  |          |  |      ****         ****   ..betaturn..           | ||             ****|  |****||           ****|     |   |                                         |||||****         ****|            ..   ****  |  ****                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |  |  |    |  |                      |  |          | |      |  |         ***|  |       |  |                                   ****      ..    |  |               |  | |                       ..nest..                      || | | |***             ***            |   ***|           |  |                     *****|  | ||                |  |                        ***                           ***        |  |       |  |          |  |      |  |                ..nest..           | ||              |  |  |  ****             ***     |   |                                         ****||| |           ***            ..      |  |  |  |                    |  ||   |                      
search RasMol script viewer Motif-ligand binding stats  niche ..     ****  ****    ****                      ****          ***      ****            ****       ****                                    ***      ..    ****               **** |                       ..niche..                      **** | |                               |   |  |           ****                       ****  ****                ****                                                                 ****       ****          ****      ****                ..niche..           ****              ****  |    |                      |   |                                             *****                          ..      ****  ****                    ****|   |                      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                                                ..                          | |                       ..schellmannloop..                       |   | |                               |   |  |                                              |                                                                                                                                             ..schellmannloop..           | |                     ******                      |   |                                                                            ..                                        |   |                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                                ..                          | |                       ..stmotif..                       |   | |                               |   |  |                                              |                                                                                                                                             ..stmotif..           | |                                                 *****                                                                            ..                                        *****                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                ..                          | |                       ..ststaple..                       |   | |                               *****  |                                              |                                                                                                                                             ..ststaple..           | |                                                                                                                                  ..                                                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                ..                          ***                       ..stturn..                       |   ***                                      |                                              |                                                                                                                                             ..stturn..           ***                                                                                                                                  ..                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                ..                                                    ..REP00000..                       *                                            *                                              *                                                                                                                                             ..REP00000..                                                                                                                                                ..                                                                   

chain C : DNA (5'-D(P*AP*GP*CP*CP*GP*AP*GP*C)-3')
JMol viewer RasMol script viewer  MG 102F  ..        
JMol viewer RasMol script viewer  AKE 101F  ..      **
JMol viewer RasMol script viewer  MG 1302A  ..      ||
JMol viewer RasMol script viewer  MG 1301A  ..      ||
sec str:  ..........
sequence :  ..AGCCGAGC
seq num:  ..1       

chain D : DNA (5'-D(P*TP*GP*CP*AP*GP*CP*TP*CP*GP*GP*CP*T)-3
JMol viewer RasMol script viewer  AKE 101F  ..*           
JMol viewer RasMol script viewer  MG 102D  ..|           
JMol viewer RasMol script viewer  AKE 101D  ..|  ***      
sec str:  ..............
sequence :  ..TGCAGCTCGGCT
seq num:  ..9           

chain E : DNA (5'-D(P*AP*GP*CP*CP*GP*AP*GP*C)-3')
JMol viewer RasMol script viewer  MG 102D  ..        
JMol viewer RasMol script viewer  AKE 101D  ..      **
JMol viewer RasMol script viewer  MG 1302B  ..      ||
JMol viewer RasMol script viewer  MG 1301B  ..      ||
sec str:  ..........
sequence :  ..AGCCGAGC
seq num:  ..1       

chain F : DNA (5'-D(P*TP*GP*CP*AP*GP*CP*TP*CP*GP*GP*CP*T)-3
JMol viewer RasMol script viewer  MG 102F  ..            
JMol viewer RasMol script viewer  AKE 101F  ..   ***      
JMol viewer RasMol script viewer  AKE 101D  ..*  |||      
sec str:  ..............
sequence :  ..TGCAGCTCGGCT
seq num:  ..9           

   New search    4g0w:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors