triangle PDBeMotif: 4eyw  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.3.1.21
Classification transferase/transferase inhibitor    | release date: Wed, May 2, 2012
Title crystal structure of rat carnitine palmitoyltransferase 2 in with 1-[(r)-2-(3,4-dihydro-1h-isoquinoline-2-carbonyl)-pipe yl]-2-phenoxy-ethanone
Authors A.RUFER, C.JOSEPH, D.BURGER, J.BENZ, M.G.RUDOLPH, R.THOMA
Method X-RAY DIFFRACTION (resolution: 1.89Å)
PDBe Citation   
Small molecules:    search P6G P6G binding statistics P6G   search L0R L0R binding statistics L0R
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
HMAVSGPDDYLQHSIVPTMHYQDSLPRLPIPKLEDTMKRYLNAQKPLLDDSQFRRTEALCKNFETGVGKELHAHLLAQDK
QNKHTSYISGPWFDMYLTARDSIVLNFNPFMAFNPDPKSEYNDQLTRATNLTVSAVRFLKTLQAGLLEPEVFHLNPSKSD
TDAFKRLIRFVPPSLSWYGAYLVNAYPLDMSQYFRLFNSTRIPRPNRDELFTDTKARHLLVLRKGHFYVFDVLDQDGNIV
NPLEIQAHLKYILSDSSPVPEFPVAYLTSENRDVWAELRQKLIFDGNEETLKKVDSAVFCLCLDDFPMKDLIHLSHTMLH
GDGTNRWFDKSFNLIVAEDGTAAVHFEHSWGDGVAVLRFFNEVFRDSTQTPAITPQSQPAATNSSASVETLSFNLSGALK
AGITAAKEKFDTTVKTLSIDSIQFQRGGKEFLKKKQLSPDAVAQLAFQMAFLRQYGQTVATYESCSTAAFKHGRTETIRP
ASIFTKRCSEAFVRDPSKHSVGELQHMMAECSKYHGQLTKEAAMGQGFDRHLYALRYLATARGLNLPELYLDPAYQQMNH
NILSTSTLNSPAVSLGGFAPVVPDGFGIAYAVHDDWIGCNVSSYSGRNAREFLHCVQKCLEDIFDALEGKAIKT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CARNITINE O-PALMITOYLTRANSFERASE 2, MITOCHONDRIAL
member of: PANTHER:searchPTHR22589/searchPTHR22589_SF21PFAM:searchPF00755PFAMB:searchPB004761PROSITE PATTERNS:searchPS00439/searchPS00440, SUPERFAMILY:searchSSF52777UniProt:searchP18886
JMol viewer RasMol script viewer  L0R 701A  ..                                                                                                                                                *                                   *                                                                                                                                                                   *                                                                                                              ****        *                                           *   *                                          **                                                                   
sec str:  ...............hhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..........eeee....hhhhhhhhhhhhhhhhhhhhhhhhhhh......eee.hhhhhhhhhhhhhhh.....hhhhhhhhh.eee....hhhhhh.eeee......eeee.....eeeeee..eeeeee.........hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh..eeee......hhhhhhhhhhh...........eeeee.....eeeee......hhhhhhhhhhhhhhhhhh............hhhhhhee.....hhhhhhhhhhhhhhhhhhhhheeeeeeee...hhhhhhhh..hhhhhhhhhhhhhhhhhhh....eeeeee........eeee...hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh....hhhhhhhhhhhhh...eeeee.....eeeee........eeeeeee....eeeeeeee...hhhhhhhhhhhhhhhhhhhhh......
sequence :  ..DDYLQHSIVPTMHYQDSLPRLPIPKLEDTMKRYLNAQKPLLDDSQFRRTEALCKNFETGVGKELHAHLLAQDKQNKHTSYISGPWFDMYLTARDSIVLNFNPFMAFNPDPKSEYNDQLTRATNLTVSAVRFLKTLQAGLLEPEVFHLNPSKSDTDAFKRLIRFVPPSLSWYGAYLVNAYPLDMSQYFRLFNSTRIPRPNRDELFTDTKARHLLVLRKGHFYVFDVLDQDGNIVNPLEIQAHLKYILSDSSPVPEFPVAYLTSENRDVWAELRQKLIFDGNEETLKKVDSAVFCLCLDDFPMKDLIHLSHTMLHGDGTNRWFDKSFNLIVAEDGTAAVHFEHSWGDGVAVLRFFNEVFRDSTQTPAITPQSQPAATNSSASVETLSFNLSGALKAGITAAKEKFDTTVKTLSIDSIQFQRGGKEFLKKKQLSPDAVAQLAFQMAFLRQYGQTVATYESCSTAAFKHGRTETIRPASIFTKRCSEAFVRDPSKHSVGELQHMMAECSKYHGQLTKEAAMGQGFDRHLYALRYLATARGLNLPELYLDPAYQQMNHNILSTSTLNSPAVSLGGFAPVVPDGFGIAYAVHDDWIGCNVSSYSGRNAREFLHCVQKCLEDIFDALEGKAIKT
seq num:  ..32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|     | |     |  |          | | |   || ||            |   |                            | | ||||| ||| |       | | |  |   || ^***   |   || ||||         |  ||   |  |  ||  ||      | |        | ||^***           |  | |    |  |       | |||  | |        |  | |         |  ||   |      || |||| ||| | ||            |   |       ||||||  |      | |||     |||  ||||          |   |   | |||    ^*** |     ^***  | | |   |   ||||||              || ||||   |            |||   |    ||| |  |   | |||| ||||||          |  ||                 | ||||            | |||   || || |     ||||  |   |  |        |  | |    |     | ^*** | |                  | |||    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|     | |     |  |          | | |   || ||            |   |                            | | ||||| ||| |       | | |  |   ||   |    |   || ||||         |  ||   |  |  ||  ||      | |        | || | |           |  | |    |  |       | |||  | |        |  | |         |  ||   |      || |||| ||| | ||            |   |       ||||||  |      | |||     |||  ||||          |   |   | |||      |  |        |  | | |   |   ||||||              || ||||   |            |||   |    ||| |  |   | |||| ||**^*          |  ||                 | ||||            | |||   || || |     ||||  |   |  |        |  | |    |     |    | | |                  | |||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|     | |     |  |          ^** |   || ||            |   |                            | | ^**|| ||| |       | | |  |   ||   |    |   || ||||         |  ||   |  |  ||  ||      | |        | || ^**           |  | |    |  |       | |||  | |        |  | |         |  ||   |      || |||| ^** | ||            |   |       ||^**|  |      | |||     |||  ||||          |   |   | |||      |  |        |  | | |   |   |^**||              || ||||   |            |||   |    ||| |  |   ^**||| |^**            |  ||                 | ||||            ^**||   || || |     ||||  |   |  |        |  | |    |     |    | ^**                  | |||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..*     | |     |  |              |   || ||            |   |                            | | ^***| ||| |       | | |  |   ||   |    |   || ||||         ^***|   |  |  ||  ||      | |        | || |             |  | |    |  |       | |||  | |        |  | |         |  ||   |      || ||||  || | ||            |   |       ||||||  |      | |||     ||^***|||          |   |   | |||      |  |        |  | | |   |   ||| ||              || ||||   |            |||   |    ||| |  |     |||| ||              ^***|                 | ||||            | |||   || || |     ||||  |   |  |        |  | |    |     |    |                      | |||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | |     |  |              |   || ||            |   |                            | | || || ||| |       | | |  |   ||   |    |   || ||||             |   |  |  ||  ||      | |        | || |             |  | |    |  |       | |||  | |        |  | |         |  ||   |      || |^*****| | ||            |   |       ||||||  |      | |||     ||   ||||          |   |   | |||      |  |        ^***** |   |   ||| ||              || ||||   |            |^*****    ||| |  |     |||| ||              |   |                 | ||||            | |||   || || |     ||||  |   |  |        |  | ^*****     ^*****                      | |||    
search RasMol script viewer Motif-ligand binding stats  ACYLTRANSF_C_1 ..      | |     |  ****************   || ||            |   |                            | | || || ||| |       | | |  |   ||   |    |   || ||||             |   |  |  ||  ||      | |        | || |             |  | |    |  |       | |||  | |        |  | |         |  ||   |      || ||||   | | ||            |   |       ||||||  |      | |||     ||   ||||          |   |   | |||      |  |           |   |   |   ||| ||              || ||||   |            | |        ||| |  |     |||| ||              |   |                 | ||||            | |||   || || |     ||||  |   |  |        |  |                                        | |||    
search RasMol script viewer Motif-ligand binding stats  ACYLTRANSF_C_2 ..      | |     |  |                  || ||            |   |                            | | || || ||| |       | | |  |   ||   |    |   || ||||             |   |  |  ||  ||      | |        | || |             |  | |    |  |       | |||  | |        |  | |         |  ||   |      || ||||   | | ||            |   |       ||||*********************^******||          |   |   | |||      |  |           |   |   |   ||| ||              || ||||   |            | |        ||| |  |     |||| ||              |   |                 | ||||            | |||   || || |     ||||  |   |  |        |  |                                        | |||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |     |  |                  || ||            |   |                            | | || || ||| |       | | |  |   ||   |    |   || ||||             |   |  |  |*****      | |        | || |             |  | |    |  |       | |||  | |        |  | |         |  ||   |      || ||||   | | ||            |   |       ||||||  |      | |||      |   ||||          |   |   | |||      |  |           |   |   |   ||| ||              || ||||   |            | |        ||| |  |     |||| ||              |   |                 | ||||            | |||   || || |     ||||  |   |  |        |  |                                        | |||    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      | |     |  |                  || ||            |   |                            | | || || ||| |       | | |  *****|   |    |   || ||||             |   |  |  ||  |       | |        | || |             |  | |    |  |       | |||  | |        |  | |         |  |*****      || ||||   | | ||            *****       ||||||  |      | |||      |   ||||          |   |   | |||      |  |           |   |   |   ||| ||              || ||||   |            | |        ||| |  |     |||| ||              |   |                 | ||||            | |||   || || |     ||||  |   |  |        |  |                                        | |||    
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | |     |  |                  || ||            |   |                            | | || || ||| |       *** |  |    |   |    |   || ||||             |   |  |  ||  |       | |        | || |             |  | |    |  |       | |||  ***        |  ***         |  |           || ||||   | | ||                        ||||||  |      | |||      |   ||||          |   |   | |||      |  |           |   |   |   ||| ||              || ||||   |            | |        ||| |  |     |||| ||              |   |                 | ||||            | |||   || |***     ||||  |   |  |        |  |                                        | |||    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      | |     |  |                  || ||            |   |                            | | || || ||| |       | | |  |    |   |    |   || ||||             |   |  |  ||  |       | |        | || |             |  | |    |  |       *****             |  | |         |  |           || ||||   | | ||                        ||||||  |      *****      |   ||||          |   |   | |||      |  |           |   |   |   ||| ||              || ||||   |            | |        ||| |  |     |||| ||              |   |                 | ||||            | |||   || ||       ||||  |   |  |        |  |                                        | |||    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |     |  |                  ****|            |   |                            | | || || ||| |       | | |  |    |   |    |   |****||             |   |  |  |****       | |        | || |             |  | |    ****       ****|             |  | |         |  |           |****||   | | ||                        ||||||  |      ****|      |   ||||          |   |   ****|      |  |           |   |   |   |****|              |****||   |            | |        ||| |  |     |||| ||              |   |                 ****||            ****|   ****|       ||||  |   |  |        |  |                                        ****|    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | |     |  |                   |  |            |   |                            | | || || *** |       | | |  |    |   |    |   |  ||||             |   |  |  |           | |        | || |             |  | |                 | |             |  | |         |  |           |  ||||   | | ||                        ||||||  |        | |      |   ||||          |   |   | |||      |  |           |   |   |   | |  |              |  | ||   |            | |        ||| |  |     |||| ||              |   |                   ||||              | |    |  |       ***|  |   |  |        |  |                                          | |    
search RasMol script viewer Motif-ligand binding stats  nest ..      | |     |  |                   |  |            |   |                            | | || || ||  |       | | |  |    |   |    |   |  ****             |   |  |  |           ***        | || |             |  | |                 ***             |  | |         |  |           |  ****   | | ||                        ****||  |        ***      |   ****          |   |   | |||      |  |           |   |   |   | |  |              |  ***|   |            ***        ||| |  |     |||| ||              |   |                   ****              ***    |  |        | |  |   |  |        |  |                                          ***    
search RasMol script viewer Motif-ligand binding stats  niche ..      ***     ****                   ****            |   |                            | *************       *** ****    |   |    |   |   ***             |   |  ****                      ******             ******                                 ******         ****           |    |    | ****                         ********                 |                 |   |   ****|      ****           |   |   |   | ****              |    ||   |                       |*******     ***| ||              |   |                                            ****        ***  |   ****        ****                                                 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..      | |                                            |   |                            |   |   | |                       |   |    |   ******              |   |                                                                                                                    ******    |   |                                                   |                 |   |   | | |                     |   |   |   |                   ******|   |                       | |           | | ||              |   |                                                             |                                                                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..      | |                                            |   |                            |   |   | |                       |   |    |   |                   *****                                                                                                                              |   |                                                   |                 |   |   *****                     |   |   |   |                         *****                       | |           | | ||              *****                                                             |                                                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..      | |                                            *****                            *****   | |                       *****    *****                                                                                                                                                      *****                                                   |                 *****   | |                       *****   *****                                                     | |           ******                                                                                |                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..      ***                                                                                     ***                                                                                                                                                                                                                                                   |                         ***                                                                                         ***             ***                                                                                 |                                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                                                                                                    *                                                                                                                                                                                                                         *                                                                    

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : CARNITINE O-PALMITOYLTRANSFERASE 2, MITOCHONDRIAL
member of: PANTHER:searchPTHR22589/searchPTHR22589_SF21PFAM:searchPF00755PFAMB:searchPB004761PROSITE PATTERNS:searchPS00439/searchPS00440, SUPERFAMILY:searchSSF52777UniProt:searchP18886
JMol viewer RasMol script viewer  P6G 702B  ..                                                                                                                                                                                                                                                                                                                      *                                                                                                               *                                                                                                                                              *        **            **       ***                                  
JMol viewer RasMol script viewer  L0R 701B  ..                                                                                                                                                       *                                   *                                                                                                                          |                                        *                                                                      |                                       ****        *                                           *   *                                          |*       ||            ||       |||                                  
sec str:  ......................hhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..........eeee....hhhhhhhhhhhhhhhhhhhhhhhhhhh......eee.hhhhhhhhhhhhhhh.....hhhhhhhhh.eee....hhhhhh.eeee......eeee.....eeeeee..eeeeee.........hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh...eeee......hhhhhhhhhhh...........eeeee.....eeeee......hhhhhhhhhhhhhhhhhh............hhhhhhee.....hhhhhhhhhhhhhhhhhhhh.eeeeeeee...hhhhhhhh..hhhhhhhhhhhhhhhhhhh....eeeeee........eeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh....hhhhhhhhhhhhh...eeeee.....eeeee........eeeeeee....eeeeeeee...hhhhhhhhhhhhhhhhhhhhh......
sequence :  ..HMAVSGPDDYLQHSIVPTMHYQDSLPRLPIPKLEDTMKRYLNAQKPLLDDSQFRRTEALCKNFETGVGKELHAHLLAQDKQNKHTSYISGPWFDMYLTARDSIVLNFNPFMAFNPDPKSEYNDQLTRATNLTVSAVRFLKTLQAGLLEPEVFHLNPSKSDTDAFKRLIRFVPPSLSWYGAYLVNAYPLDMSQYFRLFNSTRIPRPNRDELFTDTKARHLLVLRKGHFYVFDVLDQDGNIVNPLEIQAHLKYILSDSSPVPEFPVAYLTSENRDVWAELRQKLIFDGNEETLKKVDSAVFCLCLDDFPMKDLIHLSHTMLHGDGTNRWFDKSFNLIVAEDGTAAVHFEHSWGDGVAVLRFFNEVFRDSTQTPAITPQSQPAATNSSASVETLSFNLSGALKAGITAAKEKFDTTVKTLSIDSIQFQRGGKEFLKKKQLSPDAVAQLAFQMAFLRQYGQTVATYESCSTAAFKHGRTETIRPASIFTKRCSEAFVRDPSKHSVGELQHMMAECSKYHGQLTKEAAMGQGFDRHLYALRYLATARGLNLPELYLDPAYQQMNHNILSTSTLNSPAVSLGGFAPVVPDGFGIAYAVHDDWIGCNVSSYSGRNAREFLHCVQKCLEDIFDALEGKAIKT
seq num:  ..25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       635       645       655 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   ||| | |   | |     |  |          | | |   || ||   |   |    |   |             |  |           | | ||||| ||  |       | | |  |      ^***   |   |  ||||         |  |       |  |           | |        | ||^***           |  | |               | |||  | |||      |  | |        || |||   |      || |||| ||| | ||                        ||||||  |        | |     |||  ||||       |  ||  |   | |||    ^*** |     ^***  | | |        |||||              || ||||   |            |||   |    ||| |  |   | |||| ||||||      |  ||  ||                || ||||            | | |   || || |     ||||  |   |  |        |  | |    ||  | | ^***|| || | |               | |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   ||| | |   | |     |  |          | | |   || ||   |   |    |   |             |  |           | | ||||| ||  |       | | |  |             |   |  ||||         |  |       |  |           | |        | || | |           |  | |               | |||  | |||      |  | |        || |||   |      || |||| ||| | ||                        ||||||  |        | |     |||  ||||       |  ||  |   | |||      |  |        |  | | |        |||||              || ||||   |            |||   |    ||| |  |   | |||| ||**^*      |  ||  ||                || ||||            | | |   || || |     ||||  |   |  |        |  | |    ||  | |    ||| || | |               | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||| | |   | |     |  |          ^** |   || ||   |   |    |   |             |  |           | | ^**|| ||  |       | | |  |             |   |  ||||         |  |       |  |           | |        | || ^**           |  | |               | |||  | |||      |  | |        || |||   |      || |||| ^** | ||                        ||^**|  |        | |     |||  ||||       |  ||  |   | |||      |  |        |  | | |        ^**||              || ||||   |            |||   |    ||| |  |   ^**||| |^**        |  ||  ||                || ||||            ^** |   || || |     ||||  |   |  |        |  | |    ||  | |    ||^**| | |               | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |^*** |   | |     |  |              |   || ||   |   |    |   |             |  |           | | ^***| ||  |       | | |  |             |   |  ||||         ^***       |  |           | |        | || |             |  | |               | |||  | |||      |  | |        || |||   |      || ||||  || | ||                        ||||||  |        | |     ||^***|||       |  ||  |   | |||      |  |        |  | | |        || ||              || ||||   |            |||   |    ||| |  |     |||| ||          |  |^***|                || ||||              | |   || || |     ||||  |   |  |        |  | |    ||  | |    ||  || | |               | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | | | |   | |     |  |              |   || ||   |   |    |   |             |  |           | | || || ||  |       | | |  |             |   |  ||||                    |  |           | |        | || |             |  | |               | |||  | |||      |  | |        || |||   |      || |^*****| | ||                        ||||||  |        | |     ||   ||||       |  ||  |   | |||      |  |        ^***** |        || ||              || ||||   |            |^*****    ||| |  |     |||| ||          |  ||   |                || ||||              | |   || || |     ||||  |   |  |        |  | ^*****|  | ^*****|  || | |               | |    
search RasMol script viewer Motif-ligand binding stats  ACYLTRANSF_C_1 ..   | | | |   | |     |  ****************   || ||   |   |    |   |             |  |           | | || || ||  |       | | |  |             |   |  ||||                    |  |           | |        | || |             |  | |               | |||  | |||      |  | |        || |||   |      || ||||   | | ||                        ||||||  |        | |     ||   ||||       |  ||  |   | |||      |  |           |   |        || ||              || ||||   |            | |        ||| |  |     |||| ||          |  ||   |                || ||||              | |   || || |     ||||  |   |  |        |  |       |  |       |  || | |               | |    
search RasMol script viewer Motif-ligand binding stats  ACYLTRANSF_C_2 ..   | | | |   | |     |  |                  || ||   |   |    |   |             |  |           | | || || ||  |       | | |  |             |   |  ||||                    |  |           | |        | || |             |  | |               | |||  | |||      |  | |        || |||   |      || ||||   | | ||                        ||||*********************^******||       |  ||  |   | |||      |  |           |   |        || ||              || ||||   |            | |        ||| |  |     |||| ||          |  ||   |                || ||||              | |   || || |     ||||  |   |  |        |  |       |  |       |  || | |               | |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | | | |   | |     |  |                  *****   |   |    |   |             |  |           | | || || ||  |       | | |  |             |   |  ||||                    |  |           | |        | || |             |  | |               | |||  *****      |  | |        || |||   |      || ||||   | | ||                        ||||||  |        | |      |   ||||       |  ||  |   | |||      |  |           |   |        || ||              || ||||   |            | |        ||| |  |     |||| ||          |  ||   |                || ||||              | |   || || |     ||||  |   |  |        |  |       |  |       |  || | |               | |    
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | | | |   | |     |  |                  || ||   |   |    |   |             |  |           | | || || ||  |       | | |  |             |   |  ||||                    |  |           | |        | || |             |  | |               | |||  *****      |  | |        || ||*****      || ||||   | | ||                        ||||||  |        | |      |   ||||       |  ||  |   | |||      |  |           |   |        || ||              || ||||   |            | |        ||| |  |     |||| ||          |  ||   |                || ||||              | |   || || |     ||||  |   |  |        |  |       |  |       |  |*****               | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | | | |   | |     |  |                  || ||   |   |    |   |             |  |           | | || || ||  |       *** |  |             |   |  ||||                    |  |           | |        | || |             |  | |               | |||  ***|       |  | |        || ||           || ||||   | | ||                        ||||||  |        | |      |   ||||       |  ||  |   | |||      |  |           |   |        || ||              || ||||   |            | |        ||| |  |     |||| ||          |  ||   |                || ||||              | |   || |***     ||||  |   |  |        |  |       |  |       |  |***                 | |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   | | | |   | |     |  |                  || ||   |   |    |   |             |  |           | | || || ||  |       | | |  |             |   |  ||||                    |  |           | |        | || |             |  | |               *****  |  |       |  | |        || ||           || ||||   | | ||                        ||||||  |        | |      |   ||||       |  ||  |   | |||      |  |           |   |        || ||              || ||||   |            | |        ||| |  |     |||| ||          |  ||   |                || ||||              | |   || ||       ||||  |   |  |        |  |       |  |       |  |                    | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | | | |   | |     |  |                  ****|   |   |    |   |             ****           | | || || ||  |       | | |  |             |   |  ||||                    |  |           | |        | || |             |  | |               ****|  ****       **** |        ****|           |****||   | | ||                        ||||||  |        | |      |   ||||       |  ||  |   ****|      |  |           |   |        ****|              |****||   |            | |        ||| |  |     |||| ||          |  ||   |                |****||              | |   ****|       ||||  |   |  |        |  |       |  |       ****                    | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   *** | |   | |     |  |                   |  |   |   |    |   |                            | | || || ||  |       | | |  |             |   |  ||||                    |  |           | |        | || |             |  | |                 | |             |  | |         |  |           |  ||||   | | ||                        ||||||  |        | |      |   ||||       |  ||  |   | |||      |  |           |   |         |  |              |  | ||   |            | |        ||| |  |     |||| ||          |  ||   |                |  ||||              | |    |  |       ***|  |   |  |        |  |       |  |       |  |                    | |    
search RasMol script viewer Motif-ligand binding stats  nest ..       | |   | |     |  |                   |  |   |   |    |   |                            | | || || ||  |       | | |  |             |   |  ****                    |  |           ***        | || |             |  | |                 ***             |  | |         |  |           |  ****   | | ||                        ****||  |        ***      |   ****       |  ||  |   | |||      |  |           |   |         |  |              |  ***|   |            ***        ||| |  |     |||| ||          |  ||   |                |  ****              ***    |  |        | |  |   |  |        |  |       |  |       |  |                    ***    
search RasMol script viewer Motif-ligand binding stats  niche ..       ***   ***     ****                   ****   |   |    |   |                            | *************       *** ****             |   |   ***                    ****                      ******             ******                                 ******         ****           |    |    | ****                         ********                 |              |  ||  |   ****|      ****           |   |         ****              |    ||   |                       |*******     ***| ||          ****|   |                |    |                      ****        ***  |   ****        ****       ****       ****                           
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                   |   |    |   |                            |   |   | |                                |   |                                                                                                                                            ******    |   |                                                   |              |  ||  |   | | |                     |   |                           ******|   |                       | |           | | ||              |   |                ******                                       |                                                                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                   |   |    |   |                            |   |   | |                                |   |                                                                                                                                                      |   |                                                   |              |  ||  |   *****                     |   |                                 *****                       | |           | | ||              *****                                                             |                                                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                   *****    *****                            *****   | |                                *****                                                                                                                                                      *****                                                   |              ********   | |                       *****                                                             | |           ******                                                                                |                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                     ***                                                                                                                                                                                                                                                   |                         ***                                                                                         ***             ***                                                                                 |                                                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                                                                                                           *                                                                                                                                                                                                                         *                                                                    

   New search    4eyw:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors