triangle PDBeMotif: 4buz  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.5.1.
Classification hydrolase    | release date: Mon, Jun 24, 2013
Title sir2 complex structure mixture of ex-527 inhibitor and reaction products or of reaction substrates p53 peptide and
Authors C.STEEGBORN, M.GERTZ, M.LAKSHMINARASIMHAN, M.WEYAND
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search NAD NAD binding statistics NAD   search OCZ OCZ binding statistics OCZ   search OAD OAD binding statistics OAD   search EDO EDO binding statistics EDO
Modified residues:  search ALY ALY binding statistics ALY
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MKMKEFLDLLNESRLTVTLTGAGISTPSGIPDFRGPNGIYKKYSQNVFDIDFFYSHPEEFYRFAKEGIFPMLQAKPNLAH
VLLAKLEEKGLIEAVITQNIDRLHQRAGSKKVIELHGNVEEYYCVRCEKKYTVEDVIKKLESSDVPLCDDCNSLIRPNIV
FFGENLPQDALREAIGLSSRASLMIVLGSSLVVYPAAELPLITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVM
EEGGIS
Chain P sequence:
RHKKLMFK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NAD-DEPENDENT PROTEIN DEACETYLASE
member of: GENE3D:searchG3DSA_3.30.1600.10/searchG3DSA_3.40.50.1220HAMAP:searchMF_01968PANTHER:searchPTHR11085PFAM:searchPF02146PFAMB:searchPB000038/searchPB003584PROSITE PROFILES:searchPS50305, SUPERFAMILY:searchSSF52467UniProt:searchQ9WYW0
JMol viewer RasMol script viewer  EDO 1251A  ..                                 ..                                                                                *      *                                                                                                                    
JMol viewer RasMol script viewer  ZN 1250A  ..                                 ..                                                                                |*  *  |                 *  *                                                                                               
JMol viewer RasMol script viewer  OAD 1249A  ..                    ***  **    **..     *                                                                   *      ||  |  |                 |  |        * *                         ***  *                    **              ***              
JMol viewer RasMol script viewer  NAD 1248A  ..                    ***  **  ****..     |                                                 ****              *      ||  |  |                 |  |        | |                         ***  |                    **              ***              
JMol viewer RasMol script viewer  OCZ 1247A  ..                    |||  ||  **|*..     *                      *                          ****              *      ||  |  |                 |  |       ** |                         |||  |                    ||              |||              
sec str:  ....hhhhhhhhhhh..eeeee.hhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh....eeee....hhhhhh....eee..eeeeeeee.....eeehhhhhhhh..............eeeee.......hhhhhhhhhhhhhhh.eeeee.....ee..hhhhhhhhhh..eeeee......hhhhh.eee..hhhhhhhhhhhhh...
sequence :  ..MKMKEFLDLLNESRLTVTLTGAGISTPSGIPDF..YSQNVFDIDFFYSHPEEFYRFAKEGIFPMLQAKPNLAHVLLAKLEEKGLIEAVITQNIDRLHQRAGSKKVIELHGNVEEYYCVRCEKKYTVEDVIKKLESSDVPLCDDCNSLIRPNIVFFGENLPQDALREAIGLSSRASLMIVLGSSLVVYPAAELPLITVRSGGKLVIVNLGETPFDDIATLKYNMDVVEFARRVMEEGGIS
seq num:  ..1         11        21        31 ..43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         |^***      |   || |||   ..|| |  |     |  |            |  |  | |       | ||||  | | | ||||| ||| |      | ||     | | ||  || | || |       | |       |  |             | ||    |  |||||        |||||||         | || ||| |   |   |       ||||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         |  |       |   || |||   ..^* |  |     |  |            |  |  | |       | ||||  | | | ||||| ||| |      | ||     | **^*  || | || |       | |       |  |             | ||    |  |||||        |||||||         | || ||| |   |   |       ||||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |       |   || |||   .. | |  |     |  |            |  |  | |       | ||||  | | | ||||| ||^**      | ||     | |  |  || | || |       | |       |  |             ^**|    |  |||||        |^**|||         | || ||^**   |   |       ||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |       |   || |||   .. | |  |     ^***            |  |  | |       | ||||  | | | ||||| |||        | ||     | |  ^***| | || |       | |       |  |             |  |    |  |||||        | | |||         ^*** ||      |   |       ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |       ^***** |||   .. | |  |                     |  |  | |       | |^***** | | ||||| |||        | ||     | |  |   | | || |       | |       |  |             |  |    |  |||||        | | |||         | || ||      |   |       ||||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  |           || |||   .. | |  |                     |  |  | |       | ||||    | | ||||| |||        | ||     | |  |   | | || |       | |       |  |             |  |    |  |||||        | | |||         | || ||      *****       ||||
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  |           || |||   .. | |  |                     |  |  ***       | ||||    | | ***|| |||        ***|     | |  |   | | || |       | |       |  |             |  |    |  |||||        | | |||         | || ||                  ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |           |****|   .. | ****                     ****            ****||    | | ||||****|        |  |     | |  |   | **** |       | |       ****             |  |    |  |||||        | ****|         | ****|                  ||||
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |           |  ***   .. | |  |                     |  |              ****    | | ****  ***        |  |     ***  |   |   |  |       ***       |  |             |  |    |  |****        |   ***         | ||  |                  ****
search RasMol script viewer Motif-ligand binding stats  niche ..         ****           |    |   .. | ****                     ****                      ***    |    |        ****          |   |   ****                 ****             ****    **** ***        |   |           | |****                      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                        ******   .. | |                                                  | |    ******                      |   |                                                                 |   |           | |                          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                 .. | |                                                  | |                                *****                                                                 |   |           | |                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                 .. | |                                                  | |                                                                                                      *****           | |                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                 .. ***                                                  ***                                                                                                                      ***                          

chain P : CELLULAR TUMOR ANTIGEN P53
member of: PANTHER:searchPTHR11447/searchPTHR11447_SF6UniProt:searchP04637
JMol viewer RasMol script viewer  OAD 1249A  ..   *   
JMol viewer RasMol script viewer  NAD 1248A  ..   *   
JMol viewer RasMol script viewer  OCZ 1247A  ..   *   
sec str:  ......ee.
sequence :  ..RHKKLMF
seq num:  ..379    

   New search    4buz:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors