triangle PDBeMotif: 4bri  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.6.1.5
Classification hydrolase    | release date: Tue, Jun 4, 2013
Title legionella pneumophila ntpdase1 crystal form ii (closed) in complex with mg umppnp
Authors M.ZEBISCH, N.STRAETER, P.LAUBLE, P.SCHAEFER
Method X-RAY DIFFRACTION (resolution: 1.75Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search MES MES binding statistics MES   search UNP UNP binding statistics UNP   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPV
YFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQ
IVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMN
SVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLL
SSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRALEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
member of: PANTHER:searchPTHR11782PFAM:searchPF01150UniProt:searchQ5ZUA2
JMol viewer RasMol script viewer  MES 1397B  ..                                                                                                                                                                                                              *                          *                                                                                                                             
JMol viewer RasMol script viewer  CL 1394B  ..                                                                                        *                                 *                                                                                   |                          |                                                                                                                             
JMol viewer RasMol script viewer  CL 1396A  ..                                                                                        |                                 |                                                                                   *           **             |                                                                                                                             
JMol viewer RasMol script viewer  MES 1395A  ..                                                                                        |                                 |                                                                     *             |           ||             |        **   *                                                                                                               
JMol viewer RasMol script viewer  MG 1394A  ..                                                                                        |                                 |                                                                     |             |           ||             |        ||   |                                                                                                               
JMol viewer RasMol script viewer  UNP 1393A  ..                 ***  *                       * *                                   *   |                                 |                                ***                                  |             |           ||             |        ||   |                ** **                                                                           *  *           
sec str:  .....hhhhh.eeeeeeee....eeeeeeeeee.....eeeeeeeeeeee..hhhhh..hhhhhhhhhhhhhh.......eeeeeehhhhhh.hhhhhhhhhhhhhhhhhh....eeeeeee.hhhhhhhhhhhhhhhhh..........eeeeee...eeeeeee.......hhh.eeeeee..eeeeeeeeeee..hhhhhhh....hhhhh..............hhhhhhhhhhhhhhh..hhhhhhhhhhhhh...eeeeeehhhhhhh.........eehhhhhhhhhhhhh...hhhhhhhhh....hhhhhhhhhhhhhhhhh..........eee.hhhhh...hhhhhhhh
sequence :  ..MDTNPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHR
seq num:  ..34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |  |        |    |        | | ||  |  ||      || ||| | ||        |  |              |  |     |       | |  |           || || |         ||||||  ^***     |  |         | ||||| |    | ||   |      | |  |    |  ||  ||  |   | |   |   ||||  |      ||||      |  |        |  | | || ||       |^***       |  |        |  |     |   |          |||| ^***    | |||          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |        |    |        | | ||  |  ||      || ||| | ||        |  |              |  |     |       | |  |           || || |         ||^**|           |  |         | ||||| |    | ||   |      | |  |    |  ||  ||  |   | |   |   ^**|  |      ||||      |  |        |  | | || ||       |   |       |  |        |  |     |   |          ||||  |      | |||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |        |    |        | | ||  |  ||      || ||| | ||        |  |              |  |     |       | |  |           ^***| |         |||| |           |  |         | ||||| |    | ||   |      | |  |    |  ||  ||  |   | |   |   ^***  |      ||||      |  |        |  | | || ||       |   |       |  |        |  |     |   |          ||||  |      | |||          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |        |    |        | | ||  |  ||      || ||| | ||        |  |              |  |     ********^ |  |           ||  | |         |||| |           |  |         | ||||| |    | ||   |      | |  |    |  ||  ||  |   | |   |    ||   |      ||||      |  |        |  | | || ||       |   |       |  |        |  |     |   |          ||||  |      | |||          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |        ^*****        | | ||  |  ||      || ||| | ||        |  |              |  |               |  |           |^*****         |||| |           |  |         | ||||| |    | ^*****      ^*****    |  ||  ||  |   | |   ^*****|   |      ||||      |  |        ^***** || ||       |   |       |  |        |  |     |   |          |^*****      | |||          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     |  |                      | | ||  |  ||      || ||| | ||        |  |              |  |               |  |           |   |           |||| |           |  |         *****|| |    |  |          | |       |  ||  ||  |   | |         |   |      ||||      |  |           | | || ||       |   |       |  |        |  |     |   |          | ||  |      | |||          
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |  |                      *** ||  |  ||      || ||| ***|        |  |              |  |               |  |           |   |           |||| |           |  |         ***|||| |    |  |          | |       |  ||  ||  |   | |         |   |      ||||      |  |           | | || ||       |   |       |  |        |  |     |   |          | ||  |      | |||          
search RasMol script viewer Motif-ligand binding stats  betabulge ..     |  |                        | ||  |  **      || |||    |        |  |              |  |               |  |           |   |           |||| |           |  |         |  |||| |    |  |          | |       |  ||  ||  |   | |         |   |      ||||      |  |           | | || ||       |   |       |  |        |  |     |   |          | ||  |      | |||          
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |                        | ||  |          ****||    |        |  |              |  |               |  |           |   |           |||| |           |  |         ****||| |    ****          | |       |  ||  ||  |   | |         |   |      ||||      ****           | **** ||       |   |       |  |        |  |     |   |          | |****      ****|          
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                        ***|  |           |  ||    |        |  |              |  |               |  |           |   |           **** |           |  |         |  |||| |                  ***       |  ||  ||  |   ***         |   |      ****                     | | || ||       |   |       |  |        |  |     |   |          ***|  |        ***          
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                           ****           ****|    |        ****              ****               ****           |   |             ****           ****         ****|****                  ***       ************               |   |                               | *******       |   |       ****        ****     |   |             ****                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                       |    |                                                            *****                                             | |                                                         |   |                               |   || |        *****                            |   |                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                       ******                                                                                                              | |                                                         *****                               *****| |                                         *****                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                           ***                                                                                                  ***                                                                                    

chain B : ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
member of: PANTHER:searchPTHR11782PFAM:searchPF01150UniProt:searchQ5ZUA2
JMol viewer RasMol script viewer  MES 1397B  ..                                                                                                                                                                                           * *                                                **    *                                                                                                                
JMol viewer RasMol script viewer  MG 1396B  ..                                                                                                                                                                                           | |                                                ||    |                                                                                                                
JMol viewer RasMol script viewer  UNP 1395B  ..              ***  *                       *                                     *                                                                      ***                                | |                                                ||    |                ** **                                                                           *  *            
JMol viewer RasMol script viewer  CL 1394B  ..              |||  |                       |                                     |                                                                      |||                                | |             *           **                     ||    |                || ||                                                                           |  |            
JMol viewer RasMol script viewer  CL 1396A  ..              |||  |                       |                                     |   *                                 *                                |||                                | |             |           ||                     ||    |                || ||                                                                           |  |            
JMol viewer RasMol script viewer  MES 1395A  ..              |||  |                       |                                     |   |                                 |                                |||                                | |             *           ||             *       ||    |                || ||                                                                           |  |            
sec str:  ..hhhhh.eeeeeeee....eeeeeeeeee.....eeeeeeeeeeee..hhhhh..hhhhhhhhhhhhhh.......eeeeeehhhhhh.hhhhhhhhhhhhhhhhhh....eeeeeee.hhhhhhhhhhhhhhhhh..........eeeeee...eeeeeee.......hhh.eeeeee..eeeeeeeeeee..hhhhhhh....hhhhh..............hhhhhhhhhhhhhhh..hhhhhhhhhhhhh...eeeeeehhhhhhh.........eehhhhhhhhhhhhh...hhhhhhhhh....hhhhhhhhhhhhhhhhh..........eee.hhhhh...hhhhhhh..
sequence :  ..NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKSVQNKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEQNLDWTIGVVLHRA
seq num:  ..37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |        |    |          | ||  |          || ||| |  |        |  |              |  ||  |||       | |  |           || || |         ||||||  ^***     |  |         | ||||| |    | ||   |      | |  |    |  || |||  |   | |   |   ||||  |      ||||                  |  | | ||  |       |^***       |  |        |  | |   |   |          |||| ^***    | |||     |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |        |    |          | ||  |          || ||| |  |        |  |              |  ||  |||       | |  |           || || |         ||^**|           |  |         | ||||| |    | ||   |      | |  |    |  || |||  |   | |   |   ^**|  |      ||||                  |  | | ||  |       |   |       |  |        |  | |   |   |          |||| |||     | |||     |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |        |    |          | ||  |          || ||| |  |        |  |              |  ||  |||       | |  |           ^***| |         |||| |           |  |         | ||||| |    | ||   |      | |  |    |  || |||  |   | |   |   ^***  |      ||||                  |  | | ||  |       |   |       |  |        |  | |   |   |          |||| |||     | |||     |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |        |    |          | ||  |          || ||| |  |        |  |              |  ||  ||********^ |  |           ||  | |         |||| |           |  |         | ||||| |    | ||   |      | |  |    |  || |||  |   | |   |    ||   |      ||||                  |  | | ||  |       |   |       |  |        |  | |   |   |          |||| |||     | |||     |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |        ^*****          | ||  |          || ||| |  |        |  |              |  ||  ||          |  |           |^*****         |||| |           |  |         | ||||| |    | ^*****      ^*****    |  || |||  |   | |   ^*****|   |      ||||                  ^***** ||  |       |   |       |  |        |  | |   |   |          |^*****|     | |||     |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |                        | ||  |          || ||| |  |        |  |              |  |*****          |  |           |   |           |||| |           |  |         | ||||| |    |  |          | |       |  || |||  |   | |         |   |      ||||                     | | ||  |       |   |       |  |        |  | |   |   |          | || |||     | |||     |  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |                        | ||  |          || ||| |  |        |  |              |  ||  |           |  |           |   |           |||| |           |  |         | ||||| |    |  |          | |       |  || |||  |   | |         |   |      ||||                     | | ||  |       |   |       |  |        |  | |   |   |          | |*****     | |||     |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |                        | ||  |          || ||| |  |        |  |              |  ||  |           |  |           |   |           |||| |           |  |         ***|||| |    |  |          | |       |  || |||  |   | |         |   |      ||||                     | | ||  |       |   |       |  |        |  ***   |   |          | |***|      | |||     |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |                        | ||  |          ****|| |  |        |  |              ********           |  |           |   |           |||| |           |  |         |  |||| |    ****          | |       |  ****||  |   | |         |   |      ||||                     | | ||  |       |   |       |  |        |  |     |   |          | |****      ****|     |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |                        | ||  |           |  |***  |        |  |              |  |               |  |           |   |           |||| |           |  |         |  |||| |                  | |       |  ||  ||  |   | |         |   |      ||||                     | | ||  |       |   |       |  |        |  |     |   |          | ||  |        | |     |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                        ***|  |           |  ||    |        |  |              |  |               |  |           |   |           **** |           |  |         |  |||| |                  ***       |  ||  ||  |   ***         |   |      ****                     | | ||  |       |   |       |  |        |  |     |   |          ***|  |        ***     |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                           ****           ****|    |        ****              ****               ****           |   |             ****           ****         ****|****                  ***       ************               |   |                               | *******       |   |       ****        ****     |   |             ****                ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                    |    |                                                            *****                                             | |                                                         |   |                               |   |           *****                            |   |                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                    ******                                                                                                              | |                                                         *****                               *****                                            *****                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                        ***                                                                                                                                                                                          

   New search    4bri:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors