triangle PDBeMotif: 4br0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.6.1.   3.6.1.5
Classification hydrolase    | release date: Mon, Jun 3, 2013
Title rat ntpdase2 in complex with ca ampnp
Authors M.ZEBISCH, N.STRAETER, P.LAUBLE, P.SCHAEFER
Method X-RAY DIFFRACTION (resolution: 2.05Å)
PDBe Citation   
Small molecules:    search AU1 AU1 binding statistics AU1   search GOL GOL binding statistics GOL   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAHHHHHHVGTGSNDDDDKSPDPTQDVREPPALKYGIVLDAGSSHTSMFVYKWPADKENDTGIVGQHSSCDVQGGGISSY
ANDPSKAGQSLVRCLEQALRDVPRDRHASTPLYLGATAGMRLLNLTSPEATARVLEAVTQTLTQYPFDFRGARILSGQDE
GVFGWVTANYLLENFIKYGWVGRWIRPRKGTLGAMDLGGASTQITFETTSPSEDPGNEVHLRLYGQHYRVYTHSFLCYGR
DQILLRLLASALQIHRFHPCWPKGYSTQVLLQEVYQSPCTMGQRPRAFNGSAIVSLSGTSNATLCRDLVSRLFNISSCPF
SQCSFNGVFQPPVAGNFIAFSAFYYTVDFLTTVMGLPVGTLKQLEEATEITCNQTWTELQARVPGQKTRLADYCAVAMFI
HQLLSRGYHFDERSFREVVFQKKAADTAVGWALGYMLNLTNLIPADLPGLRKGTHFS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 2
member of: PANTHER:searchPTHR11782/searchPTHR11782_SF33PFAM:searchPF01150PROSITE PATTERNS:searchPS01238, UniProt:searchO35795
JMol viewer RasMol script viewer  GOL 1468A  ..                                                                                              *                                                                                                              **                                        *     ..GOL ..                                                                                                                                                                       
JMol viewer RasMol script viewer  GOL 1467A  ..                                                                                              |                                                                                                              ||        *                               |    *..GOL ..                     *                                                                                                                                                 
JMol viewer RasMol script viewer  GOL 1466A  ..                                                                                              |                                     *                                                           *            ||        |                               |    |..GOL ..                     |                                                                                                                             *                   
JMol viewer RasMol script viewer  GOL 1465A  ..                                                                                              |                                     |                                                           |            ||      ***            *                |    |..GOL ..                     |                                                                               *                                             |                   
JMol viewer RasMol script viewer  GOL 1464A  ..                                                                                              |                                     |                                                           |            ||  **  *|| |            |                |    |..GOL ..                     |                                                                            *  *                                             |                   
JMol viewer RasMol script viewer  CA 1463A  ..                                                                                              |                                     |                                                           |            ||  ||  ||| |            |                |    |..CA ..                     |                                                                            |  |                                             |                   
JMol viewer RasMol script viewer  AU1 1462A  ..           ****                                                                       **      |                                  *  |                                  ****                     |            ||  **  ||| |            |                |    |..AU1 ..                     |                            *   *                                           *  |*                                            |                   
sec str:  ....eeeeeeeee....eeeeeeeee.hhh......eeeeeee....hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhhhhhhh......ee..ee........eeeee...eeeeeee......hhh.eeeeee..eeeeeeeeeee..hhhhhhhhhhhhhhhhh..........eeeeehhhhhh.......... ....eeeee...hhhhhhhhhhh.........................eeeeehhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh...hhhhhh.eee..ee..ee..hhhhhhhhhh......hhhhhhhh...
sequence :  ..PALKYGIVLDAGSSHTSMFVYKWPADKENDTGIVGQHSSCDVQGGGISSYANDPSKAGQSLVRCLEQALRDVPRDRHASTPLYLGATAGMRLLNLTSPEATARVLEAVTQTLTQYPFDFRGARILSGQDEGVFGWVTANYLLENFIKYGWVGRWIRPRKGTLGAMDLGGASTQITFETTSPSEDPGNEVHLRLYGQHYRVYTHSFLCYGRDQILLRLLASALQIHRFHPCWPKGYSTQVLLQEVYQSPCTMGQ... ..SAIVSLSGTSNATLCRDLVSRLFNISSCPFSQCSFNGVFQPPVAGNFIAFSAFYYTVDFLTTVMGLPVGTLKQLEEATEITCNQTWTELQARVPGQKTRLADYCAVAMFIHQLLSRGYHFDERSFREVVFQKKAADTAVGWALGYMLNLTNLIPADLPGLRKGTHFS
seq num:  ..36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276          ... ..296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           |    |         | ^*** ||  | ||  | |  ||  ||  ||  |       |  |   ||  |    |    |   ^*** | | |   | | ||| | |       ||| |  ||   |  | |||||   |  |    | ||   |  |  | |    | |  ||| ||    |  |          | |               | ||  ||  |        |  | ||  |..PS00001..**     || ^***|   || ||^***                 |    | |   ||   |  |||   | | |      | ^*** | |  |  | || ||        |   |  | |   |||||     |  |          ^***||   ||||| |||  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           |    |         |  | | ||  | ||  | |  ||  ||  ||  |       |  |   ||  |    |    |   | || | | |   | | ||| | |       ||| |  ||   |  | |||||   |  |    **^*   |  |  | |    | |  ||| ||    |  |          | |               | ||  ||  |        |  | ||  |..PS00004..       || | | |   || |||  |                 |    | |   ||   |  |||   | | |      |  ||  | |  |  | || ||        |   |  | |   |||||     |  |            ||||   ||||**^*|  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |    |         |  | | ||  | ||  | |  ||  ||  ||  |       |  |   ||  |    |    |   | || | ^**   | | ||| | |       ||| |  ||   |  | |||||   |  |      |    |  |  | |    | |  ||| ||    |  |          | |               | ||  ||  |        |  | ||  |..PS00005..       || | | |   || |||  |                 |    | |   ||   |  |||   ^** |      |  ||  | |  |  | || ||        |   |  | |   ^**||     |  |            ||||   ||||| |||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |    |         |  | | ||  ^***  | |  ||  ||  ||  |       |  |   ||  |    |    |   | ^*** |     | | ||| | |       |^***  ||   |  | |||||   |  |      |    |  |  | |    | ^***|| ||    |  |          | |               | ||  ||  |        |  | ||  |..PS00006..       || | | |   || |||  |                 |    | |   ||   |  |||   |   |      |  |^*** |  |  | || ||        |   |  | |   ^***|     |  |            ||||   ||||| |||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ^*****         |  | | |^*****   ^*****|  ||  ||  |       |  |   ||  |    ^*****   |  |   |     | | ||| | |       | ^*****|   |  | |||||   |  |      ^*****  ^*****    | |   || ||    |  |          | |               | ||  ||  |        |  | ||  |..PS00008..       ^***** |   || |||  |                 ^***** |   ||   |  |^*****   |      |  |     |  |  | || ||        |   |  | |    |  |     |  |            ||||   ||^*****|  
search RasMol script viewer Motif-ligand binding stats  GDA1_CD39_NTPASE ..                          |  | | |           |  ||  ||  ||  |       |  |   ||  |             |  |   |     | | ||| | |       **************** |||||   |  |              |  |      | |   || ||    |  |          | |               | ||  ||  |        |  | ||  |..PS01238..        | |   |   || |||  |                        |   ||   |  | |   |   |      |  |     |  |  | || ||        |   |  | |    |  |     |  |            ||||   || || |||  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                          |  | | |           |  ||  ||  ||  |       |  |   ||  |             |  |   |     | | ||| | |               |   |    |||||   |  |              |  |      | |   || ||    |  |          | |               | ||  ||  |        |  | ||  |..asxmotif..        | *****   || |||  |                        |   ||   |  | |   |   |      |  |     |  |  | || ||        |   |  | |    |  |     |  |            ||||   || || |||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          |  | | |           ****************       |  |   ||  |             |  |   |     | | ||| | |               |   |    |||||   ****              |  |      | |   ****|    ****          | |               | ||  |****        |  | |****..betaturn..        | |       ****||  |                        |   ||   |  | |   |   |      |  |     |  |  | |****        |   |  | |    |  |     ****            ||||   ********|  
search RasMol script viewer Motif-ligand binding stats  nest ..                          |  | ***                                  |  |   ||  |             |  |   |     | | ||| | |               |   |    ****|                     |  |      | |    |  |                  ***               ***|  ||  |        |  | |    ..nest..        ***        |  ||  |                        |   ||   |  ***   |   |      |  |     |  |  | |***         |   |  ***    |  |                     ****         ***  
search RasMol script viewer Motif-ligand binding stats  niche ..                          **** ***                                  ****   |****             ****   |     | | |******               |   |     ****                     ****      ***    ****                  ***                  ********        **** |    ..niche..                   ********                        |   ||   |        |   |      ****     ****  ***            |   |         ****                      ***              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                           |   |                *****     | | | |                   |   |                                        | |                                                                  | |    ..stmotif..                                                   |   ||   |        *****                                    |   |                                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                           *****                          *******                   *****                                        | |                                                                  | |    ..ststaple..                                                   **********                                                 *****                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                 ***                                                                  ***    ..stturn..                                                                                                                                                                       

   New search    4br0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors