triangle PDBeMotif: 3zot  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.105
Classification hydrolase    | release date: Sun, Feb 24, 2013
Title structure of e.coli rhomboid protease glpg in complex with monobactam l29 (data set 2)
Authors J.M.LARGE, K.R.VINOTHKUMAR, M.FREEMAN, O.A.PIERRAT
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Small molecules:    search L6C L6C binding statistics L6C   search BNG BNG binding statistics BNG   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGS
GKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMAN
GAHIAGLAVGLAMAFVDSLN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RHOMBOID PROTEASE GLPG
member of: GENE3D:searchG3DSA_1.20.1540.10HAMAP:searchMF_01594PANTHER:searchPTHR22936PFAM:searchPF01694/searchPF12122SUPERFAMILY:searchSSF144091TIGRFAMS:searchTIGR04239UniProt:searchP09391
JMol viewer RasMol script viewer  CL 412A  ..**                                                                 *                                                                                        ..CL ..                      
JMol viewer RasMol script viewer  CL 411A  ..||                                                                 |             *                                        *                                 ..CL ..                      
JMol viewer RasMol script viewer  BNG 410A  ..||                                                                 |             |                                      * | *          *  *                 ..BNG ..                      
JMol viewer RasMol script viewer  BNG 409A  ..||         *   *                                   *               |             |                                      | | |          |  |                 ..BNG ..                      
JMol viewer RasMol script viewer  BNG 408A  ..||         |   |                                   |               |             |                                      | | |          |  |                 ..BNG ..                      
JMol viewer RasMol script viewer  BNG 407A  ..||         |   |                               *  *|               |             |    *   *                             | | |          |  |                 ..BNG ..                      
JMol viewer RasMol script viewer  BNG 406A  ..||         |   |                    *          |  ||               |             |    |   |                             | | |          |  |                 ..BNG ..                      
JMol viewer RasMol script viewer  BNG 405A  ..||         |   |  *           *     |          |  ||               |             |    |   |                             | | |          |  |                 ..BNG ..                      
JMol viewer RasMol script viewer  BNG 404A  ..||         |   |  |           |     |    *     |  ||               |             |    |   |                             | | |          |  |                 ..BNG ..                      
JMol viewer RasMol script viewer  BNG 403A  ..||         |   |  |           |     |    |     |  ||               |             |    |   |                             | | |          |  |                 ..BNG ..                 *    
JMol viewer RasMol script viewer  BNG 402A  ..||         |   |  |           |     |    |     |  ||               |             |    |   |                             | | |          |  | *               ..BNG ..                 |    
JMol viewer RasMol script viewer  L6C 401A  ..||         |   |  |           |     |    |     |  ||     **  **  * |             |    |   |                  *  **  *   | | |          |  | |   *        *  ..L6C ..    *            |    
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh........ ..hhhhhhhhhhhhhhhhhhhh..
sequence :  ..RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGM... ..ANGAHIAGLAVGLAMAFVDSLN
seq num:  ..92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242   ... ..250       260         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                 |  ||       |  |   | ^** | |  ||||||                          ^**|  ||  |   |            |    |               | |||                | ||||| ..PS00005.. ||    |   |    ||  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |  ||       |  |   | ||  | |  ||||||                             |  ||  |   |            ^*****               | |||                | ||||^*..PS00008..**^*****   ^*****|  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 *****       |  |   | ||  | |  ||||||                             |  ||  |   |                                 | |||                | ||||  ..alphabetamotif..                 |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 |  |        |  |   ***|  | |  ||||||                             |  ||  |   |                                 | |||                | ||||  ..asxturn..                 |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 ****        |  |      **** |  *****|                             |  ||  |   |                                 ****|                ****||  ..betaturn..                 |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..                             |  |      |  | |   ||  |                             |  ||  |   |                                   ***                  ****  ..nest..                 |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****      **** |   |****                             |  ||  |   |                                                              ..niche..                 **** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                            *****                                 ************                                                              ..ststaple..                      

   New search    3zot:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors