triangle PDBeMotif: 3zmi  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.105
Classification hydrolase    | release date: Mon, Feb 11, 2013
Title structure of e.coli rhomboid protease glpg in complex with monobactam l29
Authors J.M.LARGE, K.R.VINOTHKUMAR, M.FREEMAN, O.A.PIERRAT
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search L6C L6C binding statistics L6C   search BNG BNG binding statistics BNG
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGS
GKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMAN
GAHIAGLAVGLAMAFVDSL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RHOMBOID PROTEASE GLPG
member of: GENE3D:searchG3DSA_1.20.1540.10HAMAP:searchMF_01594PANTHER:searchPTHR22936/searchPTHR22936_SF2PFAM:searchPF01694/searchPF12122SUPERFAMILY:searchSSF144091TIGRFAMS:searchTIGR04239UniProt:searchP09391
JMol viewer RasMol script viewer  BNG 407A  ..                                    *                                                                                                                    ..BNG ..                     
JMol viewer RasMol script viewer  BNG 406A  ..           *   *                    |                                                                                                                    ..BNG ..                     
JMol viewer RasMol script viewer  BNG 405A  ..           *   |                    |                                                                                                                    ..BNG ..                     
JMol viewer RasMol script viewer  BNG 404A  ..           |   |                    |                                                                                                       *            ..BNG ..                     
JMol viewer RasMol script viewer  BNG 403A  ..           |   |                    |          *  *                                       *                                                 |            ..BNG ..                     
JMol viewer RasMol script viewer  BNG 402A  ..           |   |                    |          |  |                                       |                                                 |            ..BNG ..                     
JMol viewer RasMol script viewer  L6C 401A  ..           |   |                    |          |  |      **   *  *                        |                  *  **  *                       |   *        ..L6C ..    *                
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..... ..hhhhhhhhhhhhhhhhhhhh.
sequence :  ..RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDL... ..ANGAHIAGLAVGLAMAFVDSL
seq num:  ..92        102       112       122       132       142       152       162       172       182       192       202       212       222       232          ... ..250       260        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                             |  |   | ^**       || ||                          ^**   |   |   |        | | |    |               | |||  |  ||  |  || || |||..PS00005.. ||    |   |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                             |  |   | |         || ||                                |   |   |        | | ^*****               | |||  |  ||  |  || || |||..PS00008..**^*****   ^*****    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                             |  |   | |         || ||                                |   |   |        | |                      | |||  *****  ***** || |||..alphabetamotif..                     
search RasMol script viewer Motif-ligand binding stats  asxturn ..                             |  |   ***         || ||                                |   |   |        | |                      | |||  |  |   |  |  || |||..asxturn..                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                             |  |               ****|                                |   |   |        | |                      ****|  ****   ****  |****|..betaturn..                     
search RasMol script viewer Motif-ligand binding stats  nest ..                             |  |                |  |                                |   |   |        | |                        ***               |  ***..nest..                     
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                ****                                |   |   |        ***                        | |               |    |..niche..                     
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                     |   |   |                                   | |               ******..schellmannloop..                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                     *********                                   | |                     ..ststaple..                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                 ***                     ..stturn..                     

   New search    3zmi:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors