triangle PDBeMotif: 3zmh  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.105
Classification hydrolase    | release date: Mon, Feb 11, 2013
Title structure of e.coli rhomboid protease glpg in complex with monobactam l62
Authors J.M.LARGE, K.R.VINOTHKUMAR, M.FREEMAN, O.A.PIERRAT
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search L62 L62 binding statistics L62   search 78C 78C binding statistics 78C   search BNG BNG binding statistics BNG   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ERAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLG
SGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMA
NGAHIAGLAVGLAMAFVDSL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RHOMBOID PROTEASE GLPG
member of: GENE3D:searchG3DSA_1.20.1540.10HAMAP:searchMF_01594PANTHER:searchPTHR22936PFAM:searchPF01694/searchPF12122SUPERFAMILY:searchSSF144091TIGRFAMS:searchTIGR04239UniProt:searchP09391
JMol viewer RasMol script viewer  CL 410A  .. **                                                                 *                                                                                                               
JMol viewer RasMol script viewer  CL 409A  .. ||                                                                 |                                         *                                             ***    *                
JMol viewer RasMol script viewer  BNG 408A  .. ||                                                                 |                                         |                                             |||    |                
JMol viewer RasMol script viewer  BNG 407A  .. ||      *                                      **                  |                  *                      |                                             |||    |                
JMol viewer RasMol script viewer  BNG 406A  .. ||      |                                      ||                  |                  |                      |                         *  *                |||    |                
JMol viewer RasMol script viewer  BNG 405A  .. ||      |                    *      *          ||                  |                  |                      |                         |  |                |||    |                
JMol viewer RasMol script viewer  BNG 404A  .. ||      |                    |      |      *   ||                  |                  |                      |                         |  |                |||    |                
JMol viewer RasMol script viewer  BNG 403A  .. ||      |                    |      |      |   ||                  |                  |                      |                         |  |                |||    |            *   
JMol viewer RasMol script viewer  78C 402A  .. ||      |                    |      |      |   ||            *   * |                  |                      |                         |  | *   *          |||    |            |   
JMol viewer RasMol script viewer  L62 401A  .. ||      |                    |      |      |   ||        **  **  * |                  |                      *  **  *                  |  | |   *          *||    *            |   
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh.
sequence :  ..ERAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMANGAHIAGLAVGLAMAFVDSL
seq num:  ..91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |  ||       |  |   | ^**      ||||||                          ^**   |   |   |        | | |    |               | |||                  |||||| | ||    |   |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  |  ||       |  |   |  |       ||||||                                |   |   |        | | ^*****               | |||                  ||||^*****^*****   ^*****    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                  *****       |  |   |  |       ||||||                                |   |   |        | |                      | |||                  |||| | |                     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  ****        |  |   ****       *****|                                |   |   |        | |                      ****|                  |||| | |                     
search RasMol script viewer Motif-ligand binding stats  nest ..                              |  |                |  |                                |   |   |        | |                        ***                  **** | |                     
search RasMol script viewer Motif-ligand binding stats  niche ..                              ****                ****                                |   |   |        ***                        | |                       ***                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                      *********                                   | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                  ***                                               

   New search    3zmh:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors