triangle PDBeMotif: 3zlx  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.12.2
Classification transferase    | release date: Mon, Feb 4, 2013
Title crystal structure of mek1 in complex with fragment 18
Authors A.UGOLINI, C.ANDOUCHE, C.DELORME, C.MARCIREAU, F.VALLEE, G.MCCORT, K.AMANING, M.LOWINSKY, N.HALLAND, S.LLOPART, S.VOUGIER, V.STEIER
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search 5EZ 5EZ binding statistics 5EZ
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIREL
QVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSN
ILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMF
GCQVEGDAAETPPRPRTPGRPLNKKGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQL
MVHAFIKRSDAEEVDFAGWLCSTIGLNQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE1;
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24360/searchPTHR24360_SF15PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ02750
JMol viewer RasMol script viewer  5EZ 1383A  ..                                   * **                 *                                               ****  ** **                                        *  *                       ..5EZ ..                                                      ..                                                                            
sec str:  ......hhhhhhhhhhhhhhhhh....hhh.eeeeeeeee...eeeeeeee.....eeeeeeee...hhhhhhhhhhhhhhhhh........eeeeeee..eeeeee......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh......hhh.eee.....eee.....hhhhhhhh.... .........hhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhh.....hhhhhhhhhhhh..........hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh..hhhhhhhhhhh..
sequence :  ..ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMA... ..VGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGC..PMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
seq num:  ..39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209         ... ..224       234       244       254       264       274 ..307       317       327       337       347       357       367       377   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                ^**  |    |  |     ||    |     ^** |||   ||                         | ||    |   || |                                             | | | | || || | || |  |  |    |   |  ..PS00005..  ||  |     |||  |||||| |   |  |  | |                 ..          |  |       | ||   |    |  | ||| | |   |  |     |  |  |   |   || | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                  |  |    |  |     ||    |         |||   ||                         | ||    |   ^***                                             | | | | || || | ^***  |  |    |   |  ..PS00006..  ||  |     |||  |||||| |   ^***  | |                 ..          |  |       | ||   |    |  | ||| | |   |  |     ^***  |   |   || | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  |  |    |  |     |^*****         |^*****|                         | ||    ^*****                                               | | | | || || |  | |  |  |    |   |  ..PS00008..  ||  |     |^*****|||| |   |     | |                 ..          |  |       | ||   |    |  | ||| | |   |  |     |  |  |   |   || | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..                  |  |    |  |     ************************                         | ||                                                         | | | | || || |  | |  |  |    |   |  ..PS00107..  ||  |     | |  |||||| |   |     | |                 ..          |  |       | ||   |    |  | ||| | |   |  |     |  |  |   |   || | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..                  |  |    |  |     ||              | |                              | ||                                                         | ****^********  | |  |  |    |   |  ..PS00108..  ||  |     | |  |||||| |   |     | |                 ..          |  |       | ||   |    |  | ||| | |   |  |     |  |  |   |   || | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                  |  |    |  |     ||              | |                              | ||                                                         | | | | || ||    | |  |  |    |   |  ..alphabetamotif..  ||  |     | |  |***** |   |     | |                 ..          |  |       | ||   |    |  | ||| | |   |  |     |  |  |   |   || | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                  |  |    |  |     ||              | |                              | ||                                                         | | | | || ||    | |  |  |    |   |  ..asxmotif..  ||  |     | |  |||||  |   |     | |                 ..          |  |       | ||   |    |  | ||| | *****  |     |  |  *****   || | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                  |  |    |  |     ||              | |                              | ||                                                         | | | | || ||    | |  |  |    |   |  ..asxturn..  ||  |     | |  |||||  |   |     | |                 ..          |  |       | ||   |    |  | *** |     |  |     |  |      |   || | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..                  |  |    |  |     **              | |                              | ||                                                         | | | | || ||    | |  |  |    |   |  ..betabulge..  ||  |     | |  |||||  |   |     | |                 ..          |  |       | ||   |    |  | ||  |     |  |     |  |      |   || | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  ****    |  |                     | |                              | ||                                                         | | | | || ||    | |  |  |    |   |  ..betaturn..  ||  |     | |  |****  |   |     | |                 ..          |  |       | ||   |    |  | ||  |     ****     |  |      |   || | 
search RasMol script viewer Motif-ligand binding stats  nest ..                          |  |                     ***                              | ||                                                         *** *** || ||    ***  |  |    |   |  ..nest..  ||  |     ***  | ||   |   |     ***                 ..          |  |       ***|   |    |  | ||  |     |  |     |  |      |   |*** 
search RasMol script viewer Motif-ligand binding stats  niche ..                          ****                     | |                              ****                                                               | |****         ****    |   |  ..niche..  |****          | ||   |   |                         ..          ****          |   |    **********     ****     ****      |   |    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                   | |                              | |                                                                | |  |                  |   |  ..stmotif..  |              | ||   |   |                         ..                        *****                                      |   |    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                   | |                              | |                                                                | |  |                  *****  ..ststaple..  |              | |*********                         ..                                                                   *****    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                   ***                              ***                                                                | |  |                         ..stturn..  |              ***                                  ..                                                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                       * *  *                         ..REP00000..  *                                                   ..                                                                            

   New search    3zlx:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors