triangle PDBeMotif: 3zln  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification apoptosis    | release date: Mon, Feb 4, 2013
Title crystal structure of bcl-xl in complex with inhibitor (compound 3).
Authors B.J.SMITH, G.L.LESSENE, P.E.CZABOTAR, P.M.COLMAN
Method X-RAY DIFFRACTION (resolution: 2.29Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4   search H0Y H0Y binding statistics H0Y   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MSMAMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITP
GTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG
NNAAAESRKGQERLEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BCL-2-LIKE PROTEIN 1
member of: GENE3D:searchG3DSA_1.10.437.10PANTHER:searchPTHR11256/searchPTHR11256_SF12PFAM:searchPF00452/searchPF02180PRINTS:searchAPOPREGBCLX/searchBCL2FAMILYPROSITE PATTERNS:searchPS01080/searchPS01259/searchPS01260, PROSITE PROFILES:searchPS50062/searchPS50063, SMART:searchSM00265/searchSM00337SUPERFAMILY:searchSSF56854TIGRFAMS:searchTIGR00865UniProt:searchQ07817
JMol viewer RasMol script viewer  EDO 1203A  ..              *            ..                                                                                                                     
JMol viewer RasMol script viewer  EDO 1202A  ..              *   *        ..                                                                                                                     
JMol viewer RasMol script viewer  EDO 1201A  ..              *   |        ..          **                                                                                                         
JMol viewer RasMol script viewer  EDO 1200A  ..              |   |        ..          ||                                           ***                                                           
JMol viewer RasMol script viewer  EDO 1199A  ..              |   |*       ..          ||     *                                     |||                                                           
JMol viewer RasMol script viewer  SO4 1198A  ..              |   ||       ..          ||     |      **                         *   |||                                                           
JMol viewer RasMol script viewer  H0Y 1197A  ..              |   ||       ..          ||    *|   *  *****                   ** *   *|**  *  **  *                                                
sec str:  ..hhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh......hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..MSQSNRELVVDFLSYKLSQKGYSWSQF..TESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGN
seq num:  ..1         11        21     ..41        91        101       111       121       131       141       151       161       171       181       191    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | ||      | | | | ||||  ..|  | |             | |  | | |  |  | ||         | ||  | |  ||      ||   |    | |                     |   |||  ||||  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**|      ^** ^** ||||  ..|  | |             | |  | | |  |  | ||         | ||  | |  ||      ||   |    | |                     |   |||  ||||  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***            | ||||  ..^*** |             | |  | | |  |  | ||         | ||  | |  ||      ||   |    | |                     |   |||  ^***  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |               | ||||  ..     |             | |  | | |  |  | ||         | ||  ^*****|      ^*****    | |                     |   |^*****|   ^*
search RasMol script viewer Motif-ligand binding stats  BH1 ..   |               | ||||  ..     |             | |  | | |  |  | ||         | *******************        | |                     |   | |    |     
search RasMol script viewer Motif-ligand binding stats  BH2 ..   |               | ||||  ..     |             | |  | | |  |  | ||         |  |  | |   |                | |                     ************     
search RasMol script viewer Motif-ligand binding stats  BH3 ..   |               | ||||  ..     *************** |  | | |  |  | ||         |  |  | |   |                | |                         | |          
search RasMol script viewer Motif-ligand binding stats  BH4_1 ..   *********************|  ..                     |  | | |  |  | ||         |  |  | |   |                | |                         | |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                   | || |  ..                     |  | | |  |  | ||         |  |  | *****                | |                         | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..                   | || |  ..                     |  | ***  |  | ||         |  |  |                      | |                         | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | || |  ..                     |  |   |  |  | ||         *******                      | |                         | |          
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***| |  ..                     |  |   |  |  | ||                                      ***                         ***          
search RasMol script viewer Motif-ligand binding stats  niche ..                      | |  ..                     ****   ****  ****                                                                  ***          
search RasMol script viewer Motif-ligand binding stats  stturn ..                      ***  ..                                  ***                                                                                

   New search    3zln:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors