triangle PDBeMotif: 3zhv  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.2.4.2   2.2.1.5   2.3.1.61   4.1.1.71
Classification oxidoreductase    | release date: Mon, Dec 24, 2012
Title crystal structure of the suca domain of mycobacterium smegma post-decarboxylation intermediate from pyruvate (2-hydroxyethyl-thdp)
Authors M.BELLINZONI, N.BARILONE, P.M.ALZARI, T.WAGNER
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search TDW TDW binding statistics TDW   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
GDSIEDKNARVIELIAAYRNRGHLMADIDPLRLDNTRFRSHPDLDVNSHGLTLWDLDREFKVDGFAGVQRKKLRDILSVL
RDAYCRHVGVEYTHILEPEQQRWIQERVETKHDKPTVAEQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAETVIPMMD
AVIDQCAEHGLDEVVIAMPHRGRLNVLANIVGKPYSQIFSEFEGNLNPSQAHGSGDVKYHLGATGTYIQMFGDNDIEVSL
TANPSHLEAVDPVLEGLVRAKQDLLDTGEEGSDNRFSVVPLMLHGDAAFAGQGVVAETLNLALLRGYRTGGTIHIVVNNQ
IGFTTAPTDSRSSEYCTDVAKMIGAPIFHVNGDDPEACAWVARLAVDFRQAFKKDVVIDMLCYRRRGHNEGDDPSMTQPY
MYDVIDTKRGSRKAYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELEKHEIEPSESVEADQQIPSKLATAVDKAM
LQRIGDAHLALPEGFTVHPRVRPVLEKRREMAYEGRIDWAFAELLALGSLIAEGKLVRLSGQDTQRGTFTQRHAVIVDRK
TGEEFTPLQLLATNPDGTPTGGKFLVYNSALSEFAAVGFEYGYSVGNPDAMVLWEAQFGDFVNGAQSIIDEFISSGEAKW
GQLSDVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTIAMPSTPANYFHLLRRHGKDGIQRPLIVFTPKSMLRNKAAV
SDIRDFTESKFRSVLEEPMYTDGEGDRNKVTRLLLTSGKIYYELAARKAKENREDVAIVRIEQLAPLPRRRLAETLDRYP
NVKEKFWVQEEPANQGAWPSFGLTLPEILPDHFTGLKRISRRAMSAPSSGSSKVHAVEQQEILDTAFG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : MULTIFUNCTIONAL 2-OXOGLUTARATE METABOLISM ENZYME
member of: GENE3D:searchG3DSA_3.40.50.970PANTHER:searchPTHR23152/searchPTHR23152_SF1PFAM:searchPF00676/searchPF02779PIRSF:searchPIRSF000157SMART:searchSM00861SUPERFAMILY:searchSSF52518TIGRFAMS:searchTIGR00239UniProt:searchA0R2B1
JMol viewer RasMol script viewer  TDW 2001D  ..                                ..         ..                                                                                                                                    ..TDW ..                                                     ..                                                                                                                                                                                    ..TDW ..                                                                      *                                                * *                       *   *                                       *                                                                                                                                                                                                               
JMol viewer RasMol script viewer  CA 2003C  ..                                ..         ..                                                                                                                                    ..CA ..                                                     ..                                                                                                                                                                                    ..CA ..                                                                      |                                                | |                       |   |                       *               |                                  *  * *                                                                                                                                                                       
JMol viewer RasMol script viewer  MG 2002C  ..                                ..         ..                                                                                                                                    ..MG ..                                                     ..           *                                * *                                                                                                                                     ..MG ..                                                                      |                                                | |                       |   |                       |               |                                  |  | |                                                                                                                                                                       
JMol viewer RasMol script viewer  TDW 2001C  ..                                ..         ..                                                                                                              *                     ..TDW ..                             ***                     ..          ****   *                          * **                                                                 *                                                                  ..TDW ..                                                                      |                                                | |                       |   |                       |               |                                  |  | |                                                                                                                                                                       
sec str:  ..hhhhhhhhhhhhhhhhhh............................hhhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.....hhhhhhhhhhhhhhhh...eeeee....hhhhhhhhh...hhhhhh...... ..hhhhh..eeeeee......eeeeee.........hhhhhhhhhhhhhhhhh.......eeeeeeeehhhhhhhhhhhhhhh............eeeeee.......hhhhhh.....hhhhhhhh..eeeee..hhhhhhhhhhhhhhhhhhhh..eeeeee................hhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh... .......hhhhhhhhhhhh............hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..eeeeee..............ee......eehhhhhhh..........eeeeee....hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhh..hhhhhhh.....eeeee.............hhhhhhhhh.....eee...hhhhhhhhhhhhhhh.....eeeee.hhhhh......hhhhhhh.....ee.hhhhhh...hhhhh.eeeee..hhhhhhhhhhhhhh...eeeeee.eee..hhhhhhhhhh......eeeeeeeee....hhhhhhhhhhhhhhhhhh..eeeee.........hhhhhhhhhhhhhhhhh.
sequence :  ..NARVIELIAAYRNRGHLMADIDPLRLDNTRFR..LWDLDREFK..KKLRDILSVLRDAYCRHVGVEYTHILEPEQQRWIQERVETKHDKPTVAEQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAETVIPMMDAVIDQCAEHGLDEVVIAMPHRGRLNVLANIVGKPYSQIFSEF... ..DVKYHLGATGTYIQMFGDNDIEVSLTANPSHLEAVDPVLEGLVRAKQDLLDTG..RFSVVPLMLHGDAAFAGQGVVAETLNLALLRGYRTGGTIHIVVNNQIGFTTAPTDSRSSEYCTDVAKMIGAPIFHVNGDDPEACAWVARLAVDFRQAFKKDVVIDMLCYRRRGHNEGDDPSMTQPYMYDVIDTKRGSRKAYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELEKH... ..LATAVDKAMLQRIGDAHLALPEGFTVHPRVRPVLEKRREMAYEGRIDWAFAELLALGSLIAEGKLVRLSGQDTQRGTFTQRHAVIVDRKTGEEFTPLQLLATNPDGTPTGGKFLVYNSALSEFAAVGFEYGYSVGNPDAMVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSDVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTIAMPSTPANYFHLLRRHGKDGIQRPLIVFTPKSMLRNKAAVSDIRDFTESKFRSVLEEPMYTDGEGDRNKVTRLLLTSGKIYYELAARKAKENREDVAIVRIEQLAPLPRRRLAETLDRYPNVKEKFWVQEEPANQGAWPSFGLTLPEILPDHFTGLKRISRRAMSAPSSGSSKVHAVEQQEILDTAFG
seq num:  ..367       377       387         ..412      ..430       440       450       460       470       480       490       500       510       520       530       540       550         ... ..575       585       595       605       615          ..634       644       654       664       674       684       694       704       714       724       734       744       754       764       774       784       794       804       ... ..831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991       1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..               |  || | ||||     ..  |  |   ..                  |  | || |         |  |  |  |  ||          |   ||  ||  | **^*|||||            || |||       | || |      | |   |  |  ..PS00004..  |  ||    | |  | |         ||| | |     |    |   | | .. | |          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            | |**^*|| ||   | ||||| ||                         ..PS00004.. ||| | |||          |  |  |  ||    |     |              | || |||    |  ||||  |||||||     | ||     |  || ||| | |          |          | ||  ||          |  | | ||   || |  | | | |        ||||   ||||||  |  || |||      |   |         | |       | | |  | |             ||  |   || ||| |  |      ||| |         | |  |    | |||             |  |      | ||  ||   ||  |  |   | || |**^* |      | | |       |   |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..               |  || | ||||     ..  |  |   ..                  |  | || |         |  |  |  |  ||          |   ||  ||  | |  ||||||            || |||       | || |      | |   |  |  ..PS00005..  |  ||    | |  | |         ||| | |     |    |   | | .. | |          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            | ^**|^** ||   | ||||^**|                         ..PS00005.. ||| | |||          |  |  |  ||    |     |              | || |||    |  |^**  |^**|||     | ||     |  || ||| | |          |          | ||  ||          |  | | ||   || |  | | | |        ||||   |^**||  |  || |||      |   |         | |       ^** |  | |             ||  |   || ||| |  |      ^** |         | |  |    | |||             |  |      | ||  ||   ||  |  |   | || |   ^**      | ^**       |   |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..               |  || | ||||     ..***  |   ..                  |  | || |         |  ^***  ^***|          |   ||  ||  | |  ||||||            || |||       | || |      | |   |  ^**..PS00006..  |  ||    | |  | |         |^*** |     |    |   | ^*.. | |          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            |  | | |  ||   | ||||^***                         ..PS00006.. |^*** |||          |  |  |  ||    |     |              | || |||    ^*** |   |||||||     ^***     |  ^***|| | |          |          | ||  ||          |  | ^***   ^***  | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |             |^***   |^***| |  |       |  |         | |  |    | |||             |  |      | ||  ||   ||  ^***   | || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..               |  || | ||||     ..  |  |   ..                  |  | || |         |  |     |   |          |   ||  ||  | |  ||||||            || |||       | || |      | |   |  |  ..PS00007..  |  ||    | |  | |         | | | |     |    |   | | .. | |          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            |  | | |  ||   | ||||                             ..PS00007.. | | | |||          |  |  |  ||    ******^              | || |||       | |   |||||||     | |      |  || ||| | |          |          | ||  ||          |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |             ********^  | | |  |       |  |         | |  |    | |||             |  |      | ||  ||   ||  |      | || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..               |  || | ||||     ..  |  |   ..                  ^*****| |         |  |     |   |          |   ||  ||  | |  ||||||            || |||       | || |      | |   |  |  ..PS00008..  |  |^***** |  | |         | | | |     ^*****   | | .. | |          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            |  | ^*****|   | ||||                             ..PS00008.. | | | |||          |  |  |  ||                         ^*****||       | |   |||||||     | |      |  || |^*****          |          | ^*****          |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |                        | | |  |       |  |         | |  |    | |||             |  |      | ||  |^*****  |      | || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  RGD ..               |  || | ||||     ..  |  |   ..                     |  | |         |  |     |   |          |   ||  ||  | |  ||||||            || |||       | || |      | |   |  |  ..PS00016..  |  |       |  | |         | | | |              | | .. | |          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            |  |   |   |   | ***|                             ..PS00016.. | | | |||          |  |  |  ||                           || |||       | |   |||||||     | |      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |                        | | |  |       |  |         | |  |    | |||             |  |      | ||  |    |   |      | || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               |  || | ||||     ..  |  |   ..                     |  | |         |  |     |   |          |   |*****  | |  ||||||            || |||       | || |      | |   |  |  ..alphabetamotif..  |  |       |  | |         | | | |              | | .. | |          |  | |   |  |  *****| |       | | | | || ||         | |||     | || |               | |             ||  |            |  |   |   |   | ||||                             ..alphabetamotif.. | | | |||          |  |  *****                           || |||       | |   |||||||     | |      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |                        | | |  |       |  |         | |  |    | |||             |  |      | ||  |    |   |      | || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..               |  || | ||||     ..  |  |   ..                     |  | |         |  |     |   |          |   ||  |   | |  ||||||            || |||       | || |      | |   |  |  ..asxmotif..  |  |       |  | |         | | | |              | | .. | |          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            |  |   |   |   | ||||                             ..asxmotif.. | | *****          |  |  |  |                            || |||       | |   |||||||     | |      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |                        | | |  |       |  |         | |  |    | |||             |  |      | ||  |    |   |      | || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..               |  || ***|||     ..  |  |   ..                     |  | |         |  |     |   |          |   ||  |   | |  ||||||            || |||       | || |      | |   |  |  ..asxturn..  |  |       |  | |         | | | |              | | .. | |          |  | |   |  |  || ||| |       | | | | || ||         | |||     ******               | |             ||  |            |  |   |   |   | ||||                             ..asxturn.. | | ***|           |  |  |  |                            || |||       | |   |||||||     | |      |  || *** | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  ***                        | | |  |       |  |         | |  |    | |||             |  |      | ||  |    |   |      | || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..               |  || | ||||     ..  |  |   ..                     |  | |         |  |     |   |          |   ||  |   | |  ||||||            || |||       | || |      | |   |  |  ..betabulge..  |  |       |  | |         | | | |              | | .. | |          |  | |   |  |  || ||| |       | | | | || ||         | |||     |  |                 | |             ||  |            |  |   |   |   | ||||                             ..betabulge.. | | |  |           |  |  |  |                            || |||       | |   |||||||     | |      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  |                          | | |  |       |  |         | |  |    | |**             |  |      | ||  |    |   |      | || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..               |  || | ||||     ..  |  |   ..                     |  | |         |  |     |   |          |   ||  |   | |  ||||||            || |||       | || |      | |   |  |  ..betabulgeloop..  |  |       |  | |         | | | |              | | .. | |          |  | |   |  |  || ||| |       | | | | || ||         | |||     |  |                 | |             ||  |            |  |   |   |   | ||||                             ..betabulgeloop.. | | |  |           |  |  |  |                            || |||       | |   |||||||     | |      |  |***** | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  |                          | | |  |       |  |         | |  |    | |               |  |      | ||  |    |   |      | || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..               |  || | ||||     ..  |  |   ..                     |  | |         |  |     |   |          |   |****   | |  |****|            |****|       | || |      | |   |  |  ..betaturn..  |  |       |  | |         | | | |              | | .. | |          |  | |   |  |  ****|| |       | | | | ****|         ****|     |  |                 | |             ||  |            ****   |   |   ****||                             ..betaturn.. | | ****           ****  ****                            |****|       | |   |||||||     | |      |  |****| | |          |          |  |  |           ****   ||   ||    | | | |        ||||   ||||||  |  |****|      |   |         | |           |  |                          | | |  |       ****         | |  |    | |               |  |      | |****    |   |      | || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  nest ..               |  || | ****     ..  |  |   ..                     |  | |         |  |     |   |          |   |   |   ***  | |***            |  ***       | |***      ***   |  |  ..nest..  |  |       |  | |         | | ***              *** .. ***          |  | |   |  |  ||  |***       *** | |  |  |           ***     |  |                 ***             ||  |            |  |   |   |     ****                             ..nest.. | |                |  |                                  |  ***       ***   *******     ***      |  |  *** ***          |          |  |  |                  ||   ||    *** | |        ****   ||****  |  |  ***      |   |         ***           |  |                          | | |  |                    ***  |    | |               |  |      | |        |   |      | || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  niche ..               *******  ***     ..  ****   ..                     ******         ****     |   |          |   |   |     ******               |    |       ***               ****  ..niche..  ****       ******         ***                      ..              **** |   |  ********              ***  ****                   ****                                 |****            ****   |   |                                      ..niche.. ***                ****                                  |    |                         | |      ****      | |          |          *******                  ||   ||        ***           |   || |    ****           |   |                       ****                          *** ****                      ****    ***               ****      ***        |   |      ******            ***         |   |   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                ..         ..                                             |   |          |   |   |                          ******                               ..schellmannloop..                                                     ..                   |   |                                                                                         |                       |   |                                      ..schellmannloop..                                                          ******                         | |                | |          |                                   ||   ||        | |           |   || |                   |   |                                                                                                                                  |   |                        | |         |   |   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                ..         ..                                             *****          |   |   |                                                               ..stmotif..                                                     ..                   |   |                                                                                         |                       |   |                                      ..stmotif..                                                                                         | |                | |          |                                   ||   ||        | |           |   || |                   *****                                                                                                                                  |   |                        | |         |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                ..         ..                                                            *********                                                               ..ststaple..                                                     ..                   *****                                                                                         |                       *****                                      ..ststaple..                                                                                         | |                | |          |                                   *******        | |           *****| |                                                                                                                                                          *****                        | |         *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                ..         ..                                                                                                                                    ..stturn..                                                     ..                                                                                                                 |                                                                  ..stturn..                                                                                         ***                ***          |                                                  ***                ***                                                                                                                                                                                       ***                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                ..         ..                                                                                                                                    ..REP00000..                                                     ..                                                                                                                 *                                                                  ..REP00000..                                                                                                                         *                                                                                                                                                                                                                                                                                   

chain D : MULTIFUNCTIONAL 2-OXOGLUTARATE METABOLISM ENZYME
member of: GENE3D:searchG3DSA_3.40.50.970PANTHER:searchPTHR23152/searchPTHR23152_SF1PFAM:searchPF00676/searchPF02779PIRSF:searchPIRSF000157SMART:searchSM00861SUPERFAMILY:searchSSF52518TIGRFAMS:searchTIGR00239UniProt:searchA0R2B1
JMol viewer RasMol script viewer  CA 2003D  ..                                 ..       ..                                                                                                                                       ..CA ..                                                                                                                                                                                                                                                ..CA ..                                                                                                                                                                                                                                *  * *                                                                                                                                                                       
JMol viewer RasMol script viewer  MG 2002D  ..                                 ..       ..                                                                                                                                       ..MG ..                                                                      *                                * *                                                                                                                                      ..MG ..                                                                                                                                                                                                                                |  | |                                                                                                                                                                       
JMol viewer RasMol script viewer  TDW 2001D  ..                                 ..       ..                                                                                                                 *                     ..TDW ..                             ***                                     ****   *                          * **                                                                 *                                                                   ..TDW ..                                                                                                                                                                                                                                |  | |                                                                                                                                                                       
JMol viewer RasMol script viewer  TDW 2001C  ..                                 ..       ..                                                                                                                 |                     ..TDW ..                             |||                                     ||||   |                          | ||                                                                 |                                                                   ..TDW ..                                                                      *                                                * *                       *   *                                       *                                  |  | |                                                                                                                                                                       
sec str:  ...hhhhhhhhhhhhhhhhhh...................eee.....eeehhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.....hhhhhhhhhhhhhhhh...eeeee....hhhhhhhhh...hhhhhh...... ..hhhhh..eeeeee......eeeeee.........hhhhhhhhhhhhhhhh............eeeeeeeehhhhhhhhhhhhhhh............eeeeee.......hhhhhh.....hhhhhhhh..eeeee..hhhhhhhhhhhhhhhhhhhh..eeeeee...........hhhhhhhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... .......hhhhhhhhhhhh............hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..eeeeee..............ee......eehhhhhhh..........eeeeee....hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhh..hhhhhhh.....eeeee.............hhhhhhhhh.....eee...hhhhhhhhhhhhhhh.....eeeee.hhhhhh.....hhhhhhh.....ee.hhhhhh...hhhhh.eeeee..hhhhhhhhhhhhhh...eeeeee.eee..hhhhhhhhhh......eeeeeeeee....hhhhhhhhhhhhhhhhhh..eeeee.........hhhhhhhhhhhhhhhhh.
sequence :  ..KNARVIELIAAYRNRGHLMADIDPLRLDNTRFR..LDREFKV..VQRKKLRDILSVLRDAYCRHVGVEYTHILEPEQQRWIQERVETKHDKPTVAEQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAETVIPMMDAVIDQCAEHGLDEVVIAMPHRGRLNVLANIVGKPYSQIFSEF... ..DVKYHLGATGTYIQMFGDNDIEVSLTANPSHLEAVDPVLEGLVRAKQDLLDTGEEGSDNRFSVVPLMLHGDAAFAGQGVVAETLNLALLRGYRTGGTIHIVVNNQIGFTTAPTDSRSSEYCTDVAKMIGAPIFHVNGDDPEACAWVARLAVDFRQAFKKDVVIDMLCYRRRGHNEGDDPSMTQPYMYDVIDTKRGSRKAYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELEKHE... ..LATAVDKAMLQRIGDAHLALPEGFTVHPRVRPVLEKRREMAYEGRIDWAFAELLALGSLIAEGKLVRLSGQDTQRGTFTQRHAVIVDRKTGEEFTPLQLLATNPDGTPTGGKFLVYNSALSEFAAVGFEYGYSVGNPDAMVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSDVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTIAMPSTPANYFHLLRRHGKDGIQRPLIVFTPKSMLRNKAAVSDIRDFTESKFRSVLEEPMYTDGEGDRNKVTRLLLTSGKIYYELAARKAKENREDVAIVRIEQLAPLPRRRLAETLDRYPNVKEKFWVQEEPANQGAWPSFGLTLPEILPDHFTGLKRISRRAMSAPSSGSSKVHAVEQQEILDTAFG
seq num:  ..366       376       386          ..415    ..427       437       447       457       467       477       487       497       507       517       527       537       547       557  ... ..575       585       595       605       615       625       635       645       655       665       675       685       695       705       715       725       735       745       755       765       775       785       795       805       ... ..831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991       1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                |  || | ||||     ..       ..                     |  | || |         |  |  |  |  ||                      | **^*|||||            || |||       | || |      | |   |  |  ..PS00004..  |  ||    |    | |         ||| | |     |    |   | || ||   ||||          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            | |**^* | |   || ||||| ||                          ..PS00004.. ||| | |            |  |  |  ||    |     |           |  |||| |||    |  ||||  |||||||     | ||     |  |  ||| | |          |          | ||  ||          |  | | ||   || |  | | | |        ||||   ||||||  |  || |||      |   |         | |       | | |  | |    |  ||    ||  |   || ||| |  |      ||| |         | |  |    | |||             |  |      | ||  ||    |  |  || || || |**^* |      | | |       |   |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                |  || | ||||     ..       ..                     |  | || |         |  |  |  |  ||                      | |  ||||||            || |||       | || |      | |   |  |  ..PS00005..  |  ||    |    | |         ||| | |     |    |   | || ||   ||||          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            | ^**|^** |   || ||||^**|                          ..PS00005.. ||| | |            |  |  |  ||    |     |           |  |||| |||    |  |^**  |^**|||     | ||     |  |  ||| | |          |          | ||  ||          |  | | ||   || |  | | | |        ||||   |^**||  |  || |||      |   |         | |       ^** |  | |    |  ||    ||  |   || ||| |  |      ^** |         | |  |    | |||             |  |      | ||  ||    |  |  || || || |   ^**      | ^**       |   |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                |  || | ||||     ..       ..                     |  | || |         |  ^***  ^***|                      | |  ||||||            || |||       | || |      | |   |  ^**..PS00006..  |  ||    |    | |         |^*** |     |    |   | ^***|   ||||          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            |  | |    |   || ||||^***                          ..PS00006.. |^*** |            |  |  |  ||    |     |           |  |||| |||    ^*** |   |||||||     ^***     |  ^***|| | |          |          | ||  ||          |  | ^***   ^***  | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||    |^***   |^***| |  |       |  |         | |  |    | |||             |  |      | ||  ||    |  ^***| || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                |  || | ||||     ..       ..                     |  | || |         |  |     |   |                      | |  ||||||            || |||       | || |      | |   |  |  ..PS00007..  |  ||    |    | |         | | | |     |    |   | ||  |   ||||          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            |  | |    |   || ||||                              ..PS00007.. | | | |            |  |  |  ||    ******^           |  |||| |||       | |   |||||||     | |      |  |  ||| | |          |          | ||  ||          |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||    ********^  | | |  |       |  |         | |  |    | |||             |  |      | ||  ||    |  |  || || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                |  || | ||||     ..       ..                     ^*****| |         |  |     |   |                      | |  ||||||            || |||       | || |      | |   |  |  ..PS00008..  |  |^*****    | |         | | | |     ^*****   | ||  |   ||||          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            |  | ^*****   || ||||                              ..PS00008.. | | | |            |  |  |  ||                      |  ^*****||       | |   |||||||     | |      |  |  |^*****          |          | ^*****          |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||               | | |  |       |  |         | |  |    | |||             |  |      | ||  |^*****  |  || || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  RGD ..                |  || | ||||     ..       ..                        |  | |         |  |     |   |                      | |  ||||||            || |||       | || |      | |   |  |  ..PS00016..  |  |          | |         | | | |              | ||  |   ||||          |  | |   |  |  || ||| |       | | | | || ||         | |||     | || |               | |             ||  |            |  |          || ***|                              ..PS00016.. | | | |            |  |  |  ||                      |   ||| |||       | |   |||||||     | |      |  |  | | | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||               | | |  |       |  |         | |  |    | |||             |  |      | ||  |        |  || || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                |  || | ||||     ..       ..                        |  | |         |  |     |   |                      | |  ||||||            || |||       | || |      | |   |  |  ..alphabetamotif..  |  |          | |         | | | |              | ||  |   ||||          |  | |   |  |  *****| |       | | | | || ||         | |||     | || |               | |             ||  |            |  |          || ||||                              ..alphabetamotif.. | | | |            |  |  *****                      |   ||| |||       | |   |||||||     | |      |  |  | | | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    *****               | | |  |       |  |         | |  |    | |||             |  |      | ||  |        ***** || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..                |  || ***|||     ..       ..                        |  | |         |  |     |   |                      | |  ||||||            || |||       | || |      | |   |  |  ..asxturn..  |  |          | |         | | | |              | ||  |   ||||          |  | |   |  |  || ||| |       | | | | || ||         | |||     ******               | |             ||  |            |  |          || ||||                              ..asxturn.. | | ***            |  |  |  |                       |   ||| |||       | |   |||||||     | |      |  |  | | | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  ***    |  |                | | |  |       |  |         | |  |    | |||             |  |      | ||  |        |  |  || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..                |  || | ||||     ..       ..                        |  | |         |  |     |   |                      | |  ||||||            || |||       | || |      | |   |  |  ..betabulge..  |  |          | |         | | | |              | ||  |   ||||          |  | |   |  |  || ||| |       | | | | || ||         | |||     |  |                 | |             ||  |            |  |          || ||||                              ..betabulge.. | |                |  |  |  |                       |   ||| |||       | |   |||||||     | |      |  |  | | | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  |      |  |                | | |  |       |  |         | |  |    | |**             |  |      | ||  |        |  |  || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                |  || | ||||     ..       ..                        |  | |         |  |     |   |                      | |  |****|            |****|       | || |      | |   |  |  ..betaturn..  |  |          | |         | | | |              | ||  |   ||||          |  | |   |  |  ****|| |       | | | | ****|         ****|     |  |                 | |             ||  |            ****          |****||                              ..betaturn.. | |                ****  ****                       |   ||****|       | |   |||||||     | |      |  |  | | | |          |          |  |  |           ****   ||   ||    | | | |        ||||   ||||||  |  |****|      |   |         | |           |  |      ****                | | |  |       ****         | |  |    | |               |  |      | |****        ****  || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  nest ..                |  || | ****     ..       ..                        |  | |         |  |     |   |                      ***  | |***            |  ***       | |***      ***   |  |  ..nest..  |  |          | |         | | ***              ***|  |   ****          |  | |   |  |  ||  |***       *** | |  |  |           ***     |  |                 ***             ||  |            |  |          |  ****                              ..nest.. | |                |  |                             |   ||  ***       ***   *******     ***      |  |  *** ***          |          |  |  |                  ||   ||    *** | |        ****   ||****  |  |  ***      |   |         ***           |  |                          | | |  |                    ***  |    | |               |  |      | |                  || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  niche ..                *******  ***     ..       ..                        ******         ****     |   |                        ******               |    |       ***               ****  ..niche..  ****          ***         ***                     ****                 **** |   |  ********              ***  ****                   ****                                 |****            ****          |    |                               ..niche.. ***                ****                             |   ||    |                         | |      ****      | |          |          *******                  ||   ||        ***           |   || |    ****           |   |                       ****                          *** ****                      ****    ***               ****      ***                  |******            ***         |   |   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                 ..       ..                                                |   |                           | |               ******                               ..schellmannloop..                                                                              |   |                                                                                         |                              ******                               ..schellmannloop..                                                     |   |******                         | |                | |          |                                   ||   ||        | |           |   || |                   |   |                                                                                                                                            |   |              | |         |   |   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                 ..       ..                                                *****                           | |                                                    ..stmotif..                                                                              |   |                                                                                         |                                                                   ..stmotif..                                                     |   |                               | |                | |          |                                   ||   ||        | |           |   || |                   *****                                                                                                                                            |   |              | |         |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                 ..       ..                                                                                | |                                                    ..ststaple..                                                                              *****                                                                                         |                                                                   ..ststaple..                                                     *****                               | |                | |          |                                   *******        | |           *****| |                                                                                                                                                                    *****              | |         *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                 ..       ..                                                                                ***                                                    ..stturn..                                                                                                                                                                            |                                                                   ..stturn..                                                                                         ***                ***          |                                                  ***                ***                                                                                                                                                                                       ***                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                 ..       ..                                                                                                                                       ..REP00000..                                                                                                                                                                            *                                                                   ..REP00000..                                                                                                                         *                                                                                                                                                                                                                                                                                   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MULTIFUNCTIONAL 2-OXOGLUTARATE METABOLISM ENZYME
member of: GENE3D:searchG3DSA_3.40.50.970PANTHER:searchPTHR23152/searchPTHR23152_SF1PFAM:searchPF00676/searchPF02779PIRSF:searchPIRSF000157SMART:searchSM00861SUPERFAMILY:searchSSF52518TIGRFAMS:searchTIGR00239UniProt:searchA0R2B1
JMol viewer RasMol script viewer  TDW 2001B  ..                                       ..          ..                                                                                                                                      ..TDW ..                                                                                                                                                                                                                                                ..TDW ..                                                                      *                                                * *                       *   *                                       *                                                                                                                                                                                                               
JMol viewer RasMol script viewer  CA 2003A  ..                                       ..          ..                                                                                                                                      ..CA ..                                                                                                                                                                                                                                                ..CA ..                                                                      |                                                | |                       |   |                                       |                                  *  * *                                                                                                                                                                       
JMol viewer RasMol script viewer  MG 2002A  ..                                       ..          ..                                                                                                                                      ..MG ..                                                                       *                                * *                                                                                                                                     ..MG ..                                                                      |                                                | |                       |   |                                       |                                  |  | |                                                                                                                                                                       
JMol viewer RasMol script viewer  TDW 2001A  ..                                       ..          ..                                                                                                                *                     ..TDW ..                              ***                                     ****   *                          * **                                                                 *                                                                  ..TDW ..                                                                      |                                                | |                       |   |                                       |                                  |  | |                                                                                                                                                                       
sec str:  ...hhhhhhhhhhhhhhhhhhh.......................hhhh.ee.....eehhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.....hhhhhhhhhhhhhhhh...eeeee....hhhhhhhhh...hhhhhh...... ..hhhhhh..eeeeee......eeeeee.........hhhhhhhhhhhhhhhh............eeeeeeeehhhhhhhhhhhhhhh............eeeeee.......hhhhhh.....hhhhhhhh..eeeee..hhhhhhhhhhhhhhhhhhhh..eeeeee................hhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh... .......hhhhhhhhhhhh............hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..eeeeee..............ee......eehhhhhhh..........eeeeee....hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhh..hhhhhhh.....eeeee.............hhhhhhhhh.....eee...hhhhhhhhhhhhhhh.....eeeee.hhhhh......hhhhhhh.....ee.hhhhhh...hhhhh.eeeee..hhhhhhhhhhhhhh...eeeeee.eee..hhhhhhhhhh......eeeeeeeee....hhhhhhhhhhhhhhhhhh..eeeee.........hhhhhhhhhhhhhhhhh.
sequence :  ..DKNARVIELIAAYRNRGHLMADIDPLRLDNTRFRSHPDL..TLWDLDREFK..QRKKLRDILSVLRDAYCRHVGVEYTHILEPEQQRWIQERVETKHDKPTVAEQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAETVIPMMDAVIDQCAEHGLDEVVIAMPHRGRLNVLANIVGKPYSQIFSEF... ..GDVKYHLGATGTYIQMFGDNDIEVSLTANPSHLEAVDPVLEGLVRAKQDLLDTGEEGSDNRFSVVPLMLHGDAAFAGQGVVAETLNLALLRGYRTGGTIHIVVNNQIGFTTAPTDSRSSEYCTDVAKMIGAPIFHVNGDDPEACAWVARLAVDFRQAFKKDVVIDMLCYRRRGHNEGDDPSMTQPYMYDVIDTKRGSRKAYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELEKH... ..LATAVDKAMLQRIGDAHLALPEGFTVHPRVRPVLEKRREMAYEGRIDWAFAELLALGSLIAEGKLVRLSGQDTQRGTFTQRHAVIVDRKTGEEFTPLQLLATNPDGTPTGGKFLVYNSALSEFAAVGFEYGYSVGNPDAMVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSDVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTIAMPSTPANYFHLLRRHGKDGIQRPLIVFTPKSMLRNKAAVSDIRDFTESKFRSVLEEPMYTDGEGDRNKVTRLLLTSGKIYYELAARKAKENREDVAIVRIEQLAPLPRRRLAETLDRYPNVKEKFWVQEEPANQGAWPSFGLTLPEILPDHFTGLKRISRRAMSAPSSGSSKVHAVEQQEILDTAFG
seq num:  ..365       375       385       395      ..411       ..428       438       448       458       468       478       488       498       508       518       528       538       548       558 ... ..574       584       594       604       614       624       634       644       654       664       674       684       694       704       714       724       734       744       754       764       774       784       794       804       ... ..831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991       1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|                |  || | ||||   | || | ..|  |  |   ..                    |  | || |         |  |  |  |  ||          |   |  || | | **^*|||||            || |||       | || |      | |   |  |  ..PS00004..   |  ||    | |  | |         ||| | |     |    |   | || || | ||||          |  | |   |  |  || ||| |      |||| | | || ||         | |||     | |||| |             | |             ||  |            | |**^*|| ||  || ||||| |||                        ..PS00004.. ||| | |||          |  |  |  ||    |     |              | || |||    |  ||||  |||||||     | ||     |  || ||| | |          |          | ||  ||          |  | | ||   || |  | | | |        ||||   ||||||  |  || |||      |   |         | |       | | |  | |    |  ||    ||  |   || ||| |  |      | |           | |  |    | |||             |  |      | ||  ||   ||  |  |  || || |**^* |      | | | |     |   |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|                |  || | ||||   | || | ..|  |  |   ..                    |  | || |         |  |  |  |  ||          |   |  || | | |  ||||||            || |||       | || |      | |   |  |  ..PS00005..   |  ||    | |  | |         ||| | |     |    |   | || || | ||||          |  | |   |  |  || ||| |      |||| | | || ||         | |||     | |||| |             | |             ||  |            | ^**|^** ||  || ||||^**||                        ..PS00005.. ||| | |||          |  |  |  ||    |     |              | || |||    |  |^**  |^**|||     | ||     |  || ||| | |          |          | ||  ||          |  | | ||   || |  | | | |        ||||   |^**||  |  || |||      |   |         | |       ^** |  | |    |  ||    ||  |   || ||| |  |      ^**           | |  |    | |||             |  |      | ||  ||   ||  |  |  || || |   ^**      | ^** |     |   |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..*                |  || | ||||   | ^*** ..^***  |   ..                    |  | || |         |  ^***  ^***|          |   |  || | | |  ||||||            || |||       | || |      | |   |  ^**..PS00006..   |  ||    | |  | |         |^*** |     |    |   | ^***| | ||||          |  | |   |  |  || ||| |      |||| | | || ||         | |||     | |||| |             | |             ||  |            |  | | |  ||  || ||||^***|                        ..PS00006.. |^*** |||          |  |  |  ||    |     |              | || |||    ^*** |   |||||||     ^***     |  ^***|| | |          |          | ||  ||          |  | ^***   ^***  | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||    |^***   |^***| |  |                    | |  |    | |||             |  |      | ||  ||   ||  ^***  || || |            | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                 |  || | ||||   |  |   ..   |  |   ..                    |  | || |         |  |     |   |          |   |  || | | |  ||||||            || |||       | || |      | |   |  |  ..PS00007..   |  ||    | |  | |         | | | |     |    |   | ||  | | ||||          |  | |   |  |  || ||| |      |||| | | || ||         | |||     | |||| |             | |             ||  |            |  | | |  ||  || |||||   |                        ..PS00007.. | | | |||          |  |  |  ||    ******^              | || |||       | |   |||||||     | |      |  || ||| | |          |          | ||  ||          |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||    ********^  | | |  |                    | |  |    | |||             |  |      | ||  ||   ||  |     || || |            | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |  || | ||||   |  |   ..   |  |   ..                    ^*****| |         |  |     |   |          |   |  || | | |  ||||||            || |||       | || |      | |   |  |  ..PS00008..   |  |^***** |  | |         | | | |     ^*****   | ||  | | ||||          |  | |   |  |  || ||| |      |||| | | || ||         | |||     | |||| |             | |             ||  |            |  | ^*****|  || |||||   |                        ..PS00008.. | | | |||          |  |  |  ||                         ^*****||       | |   |||||||     | |      |  || |^*****          |          | ^*****          |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||               | | |  |                    | |  |    | |||             |  |      | ||  |^*****  |     || || |            | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  RGD ..                 |  || | ||||   |  |   ..   |  |   ..                       |  | |         |  |     |   |          |   |  || | | |  ||||||            || |||       | || |      | |   |  |  ..PS00016..   |  |       |  | |         | | | |              | ||  | | ||||          |  | |   |  |  || ||| |      |||| | | || ||         | |||     | |||| |             | |             ||  |            |  |   |   |  || ***||   |                        ..PS00016.. | | | |||          |  |  |  ||                           || |||       | |   |||||||     | |      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||               | | |  |                    | |  |    | |||             |  |      | ||  |    |   |     || || |            | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 |  || | ||||   |  |   ..   |  |   ..                       |  | |         |  |     |   |          |   |  || | | |  ||||||            || |||       | || |      | |   |  |  ..alphabetamotif..   |  |       |  | |         | | | |              | ||  | | ||||          |  | |   |  |  *****| |      |||| | | || ||         | |||     | |||| |             | |             ||  |            |  |   |   |  || |||||   |                        ..alphabetamotif.. | | *****          |  |  *****                           || |||       | |   |||||||     | |      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    *****               | | |  |                    | |  |    | |||             |  |      | ||  |    |   |     || || |            | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                 |  || | ||||   |  |   ..   |  |   ..                       |  | |         |  |     |   |          |   |  || | | |  ||||||            || |||       | || |      | |   |  |  ..asxmotif..   |  |       |  | |         | | | |              | ||  | | ||||          |  | |   |  |  || ||| |      |||| | | || ||         | |||     ********             | |             ||  |            |  |   |   |  || |||||   |                        ..asxmotif.. | | *****          |  |  |  |                            || |||       | |   |||||||     | |      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  |                | | |  |                    | |  |    | |||             |  |      | ||  |    |   |     || || |            | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 |  || ***|||   |  |   ..   |  |   ..                       |  | |         |  |     |   |          |   |  || | | |  ||||||            || |||       | || |      | |   |  |  ..asxturn..   |  |       |  | |         | | | |              | ||  | ***|||          |  | |   |  |  || ||| |      ***| | | || ||         | |||     ******               | |             ||  |            |  |   |   |  || |||||   |                        ..asxturn.. | | ***|           |  |  |  |                            || |||       | |   |||||||     | |      |  || *** | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  ***    |  |                | | |  |                    | |  |    | |||             |  |      | ||  |    |   |     || || |            | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 |  || | ||||   |  |   ..   |  |   ..                       |  | |         |  |     |   |          |   |  || | | |  ||||||            || |||       | || |      | |   |  |  ..betabulge..   |  |       |  | |         | | | |              | ||  |   ||||          |  | |   |  |  || ||| |       | | | | || ||         | |||     |  |                 | |             ||  |            |  |   |   |  || |||||   |                        ..betabulge.. | | |  |           |  |  |  |                            || |||       | |   |||||||     | |      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  |      |  |                | | |  |                    | |  |    | |**             |  |      | ||  |    |   |     || || |            | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                 |  || | ||||   |  |   ..   |  |   ..                       |  | |         |  |     |   |          |   |  || | | |  ||||||            || |||       | || |      | |   |  |  ..betabulgeloop..   |  |       |  | |         | | | |              | ||  |   ||||          |  | |   |  |  || ||| |       | | | | || ||         | |||     |  |                 | |             ||  |            |  |   |   |  || |||||   |                        ..betabulgeloop.. | | |  |           |  |  |  |                            || |||       | |   |||||||     | |      |  |***** | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  |      |  |                | | |  |                    | |  |    | |               |  |      | ||  |    |   |     || || |            | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |  || | ||||   |  |   ..   ****   ..                       |  | |         |  |     |   |          |   |  || | | |  |****|            |****|       | || |      | |   |  |  ..betaturn..   |  |       |  | |         | | | |              | ||  |   ||||          |  | |   |  |  ****|| |       | | | | ****|         ****|     ****                 | |             ||  |            ****   |   |  |****|||   |                        ..betaturn.. | | ****           ****  ****                            |****|       | |   |||||||     | |      |  |****| | |          |          |  |  |           ****   ||   ||    | | | |        ||||   ||||||  |  |****|      |   |         | |           |  |      ****                | | |  |                    | |  |    | |               |  |      | |****    |   |     || || |            | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  nest ..                 |  || | ****   |  |   ..   |  |   ..                       |  | |         |  |     |   |          |   |  || | ***  | |***            |  ***       | |***      ***   |  |  ..nest..   |  |       |  | |         | | ***              ***|  |   ****          |  | |   |  |  ||  |***       *** | |  |  |           ***                          ***             ||  |            |  |   |   |  |  ****|   |                        ..nest.. | |                |  |                                  |  ***       ***   *******     ***      |  |  *** ***          |          |  |  |                  ||   ||    *** | |        ****   ||****  |  |  ***      |   |         ***           |  |                          | | |  |                    ***  |    | |               |  |      | |        |   |     || || |            | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  niche ..                 *******  ***   ****   ..   ****   ..                       ******         ****     |   |          |   |  ****   ******               |    |       ***               ****  ..niche..   ****       ******         ***                     ****                 **** |   |  ********              ***  ****                                                        |****            ****   |   |  |    | |   |                        ..niche.. ***                ****                                  |    |                         | |      ****      | |          |          *******                  ||   ||        ***           |   || |    ****           |   |                       ****                          *** ****                      ****    ***               ****      ***        |   |     |******            ***   |     |   |   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                       ..          ..                                               |   |          |   |   |                          ******                               ..schellmannloop..                                                                               |   |                                                                                         |                       |   |  ****** |   |                        ..schellmannloop..                                                          ******                         | |                | |          |                                   ||   ||        | |           |   || |                   |   |                                                                                                                                  |   |     |   |              | |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                       ..          ..                                               *****          |   |   |                                                               ..stmotif..                                                                               |   |                                                                                         |                       |   |         *****                        ..stmotif..                                                                                         | |                | |          |                                   ||   ||        | |           |   || |                   *****                                                                                                                                  |   |     |   |              | *****     |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                       ..          ..                                                              *********                                                               ..ststaple..                                                                               *****                                                                                         |                       *****                                      ..ststaple..                                                                                         | |                | |          |                                   *******        | |           *****| |                                                                                                                                                          *****     *****              | |         *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                       ..          ..                                                                                                                                      ..stturn..                                                                                                                                                                             |                                                                  ..stturn..                                                                                         ***                ***          |                                                  ***                ***                                                                                                                                                                                       ***                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                       ..          ..                                                                                                                                      ..REP00000..                                                                                                                                                                             *                                                                  ..REP00000..                                                                                                                         *                                                                                                                                                                                                                                                                                   

chain B : MULTIFUNCTIONAL 2-OXOGLUTARATE METABOLISM ENZYME
member of: GENE3D:searchG3DSA_3.40.50.970PANTHER:searchPTHR23152/searchPTHR23152_SF1PFAM:searchPF00676/searchPF02779PIRSF:searchPIRSF000157SMART:searchSM00861SUPERFAMILY:searchSSF52518TIGRFAMS:searchTIGR00239UniProt:searchA0R2B1
JMol viewer RasMol script viewer  CA 2003B  ..                                 ..          ..                                                                                                                                      ..CA ..                                                                                                                                                                                                                                               ..CA ..                                                                                                                                                                             *                                                  *  * *                                                                                                                                                                       
JMol viewer RasMol script viewer  MG 2002B  ..                                 ..          ..                                                                                                                                      ..MG ..                                                                      *                                * *                                                                                                                                     ..MG ..                                                                                                                                                                             |                                                  |  | |                                                                                                                                                                       
JMol viewer RasMol script viewer  TDW 2001B  ..                                 ..          ..                                                                                                                *                     ..TDW ..                             ***                                     ****   *                          * **                                                                 *                                                                  ..TDW ..                                                                                                                                                                             |                                                  |  | |                                                                                                                                                                       
JMol viewer RasMol script viewer  TDW 2001A  ..                                 ..          ..                                                                                                                |                     ..TDW ..                             |||                                     ||||   |                          | ||                                                                 |                                                                  ..TDW ..                                                                      *                                                * *                       *   *                       |               *                                  |  | |                                                                                                                                                                       
sec str:  ..hhhhhhhhhhhhhhhhhhhh....................eee.....eeehhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.....hhhhhhhhhhhhhhhh...eeeee....hhhhhhhhh...hhhhhh...... ..hhhhh..eeeeee......eeeeee.........hhhhhhhhhhhhhhhh............eeeeeeeehhhhhhhhhhhhhhh............eeeeee.......hhhhhh.....hhhhhhhh..eeeee..hhhhhhhhhhhhhhhhhhhh..eeeeee...........hhhhhhhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh... .......hhhhhhhhhhhh............hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..eeeeee..............ee......eehhhhhhh..........eeeeee....hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhh..hhhhhhh.....eeeee.............hhhhhhhhh.....eee...hhhhhhhhhhhhhhh.....eeeee.hhhhhh.....hhhhhhh.....ee.hhhhhh...hhhhh.eeeee..hhhhhhhhhhhhhh...eeeeee.eee..hhhhhhhhhhh.....eeeeeeeee....hhhhhhhhhhhhhhhhhh..eeeee.........hhhhhhhhhhhhhhhhh.
sequence :  ..DKNARVIELIAAYRNRGHLMADIDPLRLDNTRF..WDLDREFKVD..QRKKLRDILSVLRDAYCRHVGVEYTHILEPEQQRWIQERVETKHDKPTVAEQKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAETVIPMMDAVIDQCAEHGLDEVVIAMPHRGRLNVLANIVGKPYSQIFSEF... ..DVKYHLGATGTYIQMFGDNDIEVSLTANPSHLEAVDPVLEGLVRAKQDLLDTGEEGSDNRFSVVPLMLHGDAAFAGQGVVAETLNLALLRGYRTGGTIHIVVNNQIGFTTAPTDSRSSEYCTDVAKMIGAPIFHVNGDDPEACAWVARLAVDFRQAFKKDVVIDMLCYRRRGHNEGDDPSMTQPYMYDVIDTKRGSRKAYTEALIGRGDISMKEAEDALRDYQGQLERVFNEVRELEKH... ..LATAVDKAMLQRIGDAHLALPEGFTVHPRVRPVLEKRREMAYEGRIDWAFAELLALGSLIAEGKLVRLSGQDTQRGTFTQRHAVIVDRKTGEEFTPLQLLATNPDGTPTGGKFLVYNSALSEFAAVGFEYGYSVGNPDAMVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSDVVLLLPHGHEGQGPDHTSGRIERFLQLWAEGSMTIAMPSTPANYFHLLRRHGKDGIQRPLIVFTPKSMLRNKAAVSDIRDFTESKFRSVLEEPMYTDGEGDRNKVTRLLLTSGKIYYELAARKAKENREDVAIVRIEQLAPLPRRRLAETLDRYPNVKEKFWVQEEPANQGAWPSFGLTLPEILPDHFTGLKRISRRAMSAPSSGSSKVHAVEQQEILDTAFG
seq num:  ..365       375       385          ..413       ..428       438       448       458       468       478       488       498       508       518       528       538       548       558 ... ..575       585       595       605       615       625       635       645       655       665       675       685       695       705       715       725       735       745       755       765       775       785       795       805      ... ..831       841       851       861       871       881       891       901       911       921       931       941       951       961       971       981       991       1001      1011      1021      1031      1041      1051      1061      1071      1081      1091      1101      1111      1121      1131      1141      1151      1161      1171      1181      1191      1201      1211      1221   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|                |  || | ||||    .. |  |     ..   |  ||            |  | || |         |  |  |  |  ||                 |  | | **^*|||||            || |||       | || |      | |   |  |  ..PS00004.. || |||    |    | |         ||| | |     |    |   | || || | ||||          |  | |   |  |  ||  || |       | | | | || ||         | |||     | || |               | |         | | ||  |            | |**^*|| ||  || ||||| ||                         ..PS00004.. ||| |              |  |  |  ||    |     |           |  |||| |||    |  ||||  |||||||  |  ||||     |  || ||| | |          |          | ||  ||          |  | | ||   || |  | | | |        ||||   ||||||  |  || |||      |   |         | |       | | |  | |    |  ||    ||  |   || ||| |  |      ||| |         | |  |    | |||     |   |   |  |      | ||  ||   ||  |  |  || || |**^* |      | | |       |   |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|                |  || | ||||    .. |  |     ..   |  ||            |  | || |         |  |  |  |  ||                 |  | | |  ||||||            || |||       | || |      | |   |  |  ..PS00005.. || |||    |    | |         ||| | |     |    |   | || || | ||||          |  | |   |  |  ||  || |       | | | | || ||         | |||     | || |               | |         | | ||  |            | ^**|^** ||  || ||||^**|                         ..PS00005.. ||| |              |  |  |  ||    |     |           |  |||| |||    |  |^**  |^**|||  |  ||||     |  || ||| | |          |          | ||  ||          |  | | ||   || |  | | | |        ||||   |^**||  |  || |||      |   |         | |       ^** |  | |    |  ||    ||  |   || ||| |  |      ^** |         | |  |    | |||     |   |   |  |      | ||  ||   ||  |  |  || || |   ^**      | ^**       |   |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..*                |  || | ||||    ..**  |     ..   |  ||            |  | || |         |  ^***  ^***|                 |  | | |  ||||||            || |||       | || |      | |   |  ^**..PS00006.. || |||    |    | |         |^*** |     |    |   | ^***| | ||||          |  | |   |  |  ||  || |       | | | | || ||         | |||     | || |               | |         | | ||  |            |  | | |  ||  || ||||^***                         ..PS00006.. |^***              |  |  |  ||    |     |           |  |||| |||    ^*** |   |||||||  |  ^***     |  ^***|| | |          |          | ||  ||          |  | ^***   ^***  | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||    |^***   |^***| |  |       |  |         | |  |    | |||     |   |   |  |      | ||  ||   ||  ^***  || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                 |  || | ||||    .. |  |     ..   |  ||            |  | || |         |  |     |   |                 |  | | |  ||||||            || |||       | || |      | |   |  |  ..PS00007.. || |||    |    | |         | | | |     |    |   | ||  | | ||||          |  | |   |  |  ||  || |       | | | | || ||         | |||     | || |               | |         | | ||  |            |  | | |  ||  || ||||                             ..PS00007.. | |                |  |  |  ||    ******^           |  |||| |||       | |   |||||||  |  |||      |  || ||| | |          |          | ||  ||          |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||    ********^  | | |  |       |  |         | |  |    | |||     |   |   |  |      | ||  ||   ||  |     || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |  || | ||||    .. |  |     ..   |  ||            ^*****| |         |  |     |   |                 |  | | |  ||||||            || |||       | || |      | |   |  |  ..PS00008.. || ||^*****    | |         | | | |     ^*****   | ||  | | ||||          |  | |   |  |  ||  || |       | | | | || ||         | |||     | || |               | |         | | ||  |            |  | ^*****|  || ||||                             ..PS00008.. | |                |  |  |  ||                      |  ^*****||       | |   |||||||  |  |||      |  || |^*****          |          | ^*****          |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||               | | |  |       |  |         | |  |    | |||     |   |   |  |      | ||  |^*****  |     || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  RGD ..                 |  || | ||||    .. |  |     ..   |  ||               |  | |         |  |     |   |                 |  | | |  ||||||            || |||       | || |      | |   |  |  ..PS00016.. || ||          | |         | | | |              | ||  | | ||||          |  | |   |  |  ||  || |       | | | | || ||         | |||     | || |               | |         | | ||  |            |  |   |   |  || ***|                             ..PS00016.. | |                |  |  |  ||                      |   ||| |||       | |   |||||||  |  |||      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  ||               | | |  |       |  |         | |  |    | |||     |   |   |  |      | ||  |    |   |     || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 |  || | ||||    .. |  |     ..   *****               |  | |         |  |     |   |                 |  | | |  ||||||            || |||       | || |      | |   |  |  ..alphabetamotif.. *****          | |         | | | |              | ||  | | ||||          |  | |   |  |  ||  || |       | | | | || ||         | |||     | || |               | |         | | ||  |            |  |   |   |  || ||||                             ..alphabetamotif.. | |                |  |  *****                      |   ||| |||       | |   |||||||  |  |||      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    *****               | | |  |       |  |         | |  |    | |||     |   |   |  |      | ||  |    |   |     || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                 |  || | ||||    .. |  |     ..   |  |                |  | |         |  |     |   |                 |  | | |  ||||||            || |||       | || |      | |   |  |  ..asxmotif.. || ||          | |         | | | |              | ||  | | ||||          |  | |   |  |  ||  || |       | | | | || ||         | |||     | || |               | |         | | ||  |            |  |   |   |  || ||||                             ..asxmotif.. | |                |  |  |  |                       |   ||| |||       | |   |||||||  *****|      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  | |    |  |                | | |  |       |  |         | |  |    | |||     |   |   |  |      | ||  |    |   |     || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 |  || ***|||    .. |  |     ..   |  |                |  | |         |  |     |   |                 |  | | |  ||||||            || |||       | || |      | |   |  |  ..asxturn.. || ||          | |         | | | |              | ||  | ***|||          |  | |   |  |  ||  || |       | | | | || ||         | |||     ******               | |         | | ||  |            |  |   |   |  || ||||                             ..asxturn.. | |                |  |  |  |                       |   ||| |||       | |   |||||||  |  | |      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  ***    |  |                | | |  |       |  |         | |  |    | |||     |   |   |  |      | ||  |    |   |     || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 |  || | ||||    .. |  |     ..   |  |                |  | |         |  |     |   |                 |  | | |  ||||||            || |||       | || |      | |   |  |  ..betabulge.. || ||          | |         | | | |              | ||  |   ||||          |  | |   |  |  ||  || |       | | | | || ||         | |||     |  |                 | |         | | ||  |            |  |   |   |  || ||||                             ..betabulge.. | |                |  |  |  |                       |   ||| |||       | |   |||||||  |  | |      |  || ||| | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  |      |  |                | | |  |       |  |         | |  |    | |**     |   |   |  |      | ||  |    |   |     || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                 |  || | ||||    .. |  |     ..   |  |                |  | |         |  |     |   |                 |  | | |  ||||||            || |||       | || |      | |   |  |  ..betabulgeloop.. || ||          | |         | | | |              | ||  |   ||||          |  | |   |  |  ||  || |       | | | | || ||         | |||     |  |                 | |         | | ||  |            |  |   |   |  || ||||                             ..betabulgeloop.. | |                |  |  |  |                       |   ||| |||       | |   |||||||  ******      |  |***** | |          |          |  |  |           |  |   ||   ||    | | | |        ||||   ||||||  |  || |||      |   |         | |           |  |      |  |                | | |  |       |  |         | |  |    | |       |   |   |  |      | ||  |    |   |     || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |  || | ||||    .. |  |     ..   ****                |  | |         |  |     |   |                 |  | | |  |****|            |****|       | || |      | |   |  |  ..betaturn.. ****|          | |         | | | |              | |****   ||||          |  | |   |  |  ||  || |       | | | | ****|         ****|     |  |                 | |         | | ||  |            ****   |   |  |****||                             ..betaturn.. | |                ****  ****                       |   ||****|       | |   |||||||     | |      |  |****| | |          |          |  |  |           ****   ||   ||    | | | |        ||||   ||||||  |  |****|      |   |         | |           |  |      ****                | | |  |       ****         | |  |    | |       |   |   |  |      | |****    |   |     || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  nest ..                 |  || | ****    .. |  |     ..                       |  | |         |  |     |   |                 |  | ***  | |***            |  ***       | |***      ***   |  |  ..nest..  |  |          | |         | | ***              ***|  |   ****          |  | |   |  |  ||  |***       *** | |  |  |           ***     |  |                 ***         | | ||  |            |  |   |   |  |  ****                             ..nest.. | |                |  |                             |   ||  ***       ***   *******     ***      |  |  *** ***          |          |  |  |                  ||   ||    *** | |        ****   ||****  |  |  ***      |   |         ***           |  |                          | | |  |                    ***  |    | |       |   |   |  |      | |        |   |     || || |            | |         |   |   
search RasMol script viewer Motif-ligand binding stats  niche ..                 *******  ***    .. ****     ..                       ******         ****     |   |                 ****   ******               |    |       ***               ****  ..niche..  ****          ***         ***                     ****                 **** |   |  ********              ***  ****                   ****                             *** |****            ****   |   |  |    |                              ..niche.. ***                ****                             |   ||    |                         | |      ****      | |          |          *******                  ||   ||        ***           |   || |    ****           |   |                       ****                          *** ****                      ****    ***       |   |   ****      ***        |   |     |******            ***         |   |   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                 ..          ..                                               |   |                           | |               ******                               ..schellmannloop..                                                                              |   |                                                                                         |                       |   |  ******                              ..schellmannloop..                                                     |   |******                         | |                | |          |                                   ||   ||        | |           |   || |                   |   |                                                                                                     |   |                        |   |     |   |              | |         |   |   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                 ..          ..                                               *****                           | |                                                    ..stmotif..                                                                              |   |                                                                                         |                       |   |                                      ..stmotif..                                                     |   |                               | |                | |          |                                   ||   ||        | |           |   || |                   *****                                                                                                     |   |                        |   |     |   |              | |         |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                 ..          ..                                                                               | |                                                    ..ststaple..                                                                              *****                                                                                         |                       *****                                      ..ststaple..                                                     *****                               | |                | |          |                                   *******        | |           *****| |                                                                                                                             *****                        *****     *****              | |         *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                 ..          ..                                                                               ***                                                    ..stturn..                                                                                                                                                                            |                                                                  ..stturn..                                                                                         ***                ***          |                                                  ***                ***                                                                                                                                                                                       ***                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                 ..          ..                                                                                                                                      ..REP00000..                                                                                                                                                                            *                                                                  ..REP00000..                                                                                                                         *                                                                                                                                                                                                                                                                                   

   New search    3zhv:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors