triangle PDBeMotif: 3zgu  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Classification hydrolase    | release date: Wed, Dec 19, 2012
Title the 'tricorne' fold: a novel fold for a unique family of rin amidases.
Authors C.SCOTT, J.NEWMAN, L.J.BRIGGS, M.WILDING, N.COWIESON, N.G.FRENCH, S.BALOTRA, S.PANJIKA, T.S.PEAT
Method X-RAY DIFFRACTION (resolution: 3.10Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search BR8 BR8 binding statistics BR8
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MGSSHHHHHHSSGLVPRGSHMYHIDVFRIPCHSPGDTSGLEDLIETGRVAPADIVAVMGKTEGNGCVNDYTREYATAMLA
ACLGRHLQLPPHEVEKRVAFVMSGGTEGVLSPHHTVFARRPADAHRPAGKRLTLGIAFTRDFLPEEIGRHAQITETAGAV
KRAMRDAGIASIDDLHFVQVKCPLLTPAKIASARSRGCAPVTTDTYESMGYSRGASALGIALATEEVPSSMLVDESVLND
WSLSSSLASASAGIELEHNVVIAIGMSEQATSELVIAHGVMSDAIDAASVRRTIESLGIRSDDEMDRIVNVFAKAEASPD
GVVRGMRHTMLSDSDINSTRHARAVTGAAIASVVGHGMVYVSGGAEHQGPAGGGPFAVIARA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYANURIC ACID AMIDOHYDROLASE
JMol viewer RasMol script viewer  BR8 1366A  ..                                             *      *                              **                                                                                                        *   *                                     **                                                                                          *                  **                   
JMol viewer RasMol script viewer  MG 1365A  ..                                             |      |                              ||                                                                                                        |   |                                     ||                                                                                          |                  || *  * *            
sec str:  ....eeeeeeeee......hhhhhhhhhh...hhh.eeeeeeee........hhhhhhhhhhhhhhhhhh..hhhhhhhhheeeeee........eeeeeeeee.........eeeeeeee....hhhhh.hhhhhhhhhhhhhhhhhhhh..hhh.eeeeeeee...hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh........hhhhh..........eeeee.......eeeeeeee......eeeeeeee....hhhhhhhhhhhh......hhh.eeeeeeee......ee..ee.........hhhhhhhhhhhhhhhhhhh....eeee..........eeeeeeee.
sequence :  ..HMYHIDVFRIPCHSPGDTSGLEDLIETGRVAPADIVAVMGKTEGNGCVNDYTREYATAMLAACLGRHLQLPPHEVEKRVAFVMSGGTEGVLSPHHTVFARRPADAHRPAGKRLTLGIAFTRDFLPEEIGRHAQITETAGAVKRAMRDAGIASIDDLHFVQVKCPLLTPAKIASARSRGCAPVTTDTYESMGYSRGASALGIALATEEVPSSMLVDESVLNDWSLSSSLASASAGIELEHNVVIAIGMSEQATSELVIAHGVMSDAIDAASVRRTIESLGIRSDDEMDRIVNVFAKAEASPDGVVRGMRHTMLSDSDINSTRHARAVTGAAIASVVGHGMVYVSGGAEHQGPAGGGPFAVIARA
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             |  | |  |    |||||| ||         | |  | |               | |     |  |     |   |||                 | |||| |    |  || || || ||  |        | ||| || ||||        |   | | | | |   | |   |          ||   ||||   | || ||| | || | ||    |  |          |  | |                | |  || ||| |  || ||||         |||   |   | || | ^***      |  | ||| |        |  | |  |    | | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..             |  | |  |    |||||| ||         | |  | |               | |     |  |     |   |||                 | **^* |    |  || || || ||  |        | ||| || ||||        |   | | | | |   | |   |          ||   ||||   | || ||| | || | ||    |  |          |  | |                | |  || ||| |  || ||||         |||   |   | || |  | |      |  | ||| |        |  | |  |    | | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             |  | |  |    ^**||| ||         | |  | |               | |     |  |     |   |||                 |  |   |    |  || || || ||  |        | ||| || ||||        |   | ^** | |   | |   |          ||   ||||   | || ||| | || | ||    |  |          |  | |                ^**  || ||| |  || ||||         |||   |   | || |  ^**      |  | ||| |        |  | |  |    | | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             ^*** ^***    |||||| ||         | |  | |               | |     |  |     |   |||                 |  |   |    |  || || || ||  |        | ||| ^***|||        |   |     | |   | |   |          ||   ||||   | || ||| | || | ||    |  |          |  | |                     || ||| ^***| ||||         |||   |   | ^***           |  | ||| |        |  | |  |    | | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             |  |         |||||| ||         | |  | |               | |     |  |     ^*****|                 |  |   ^*****  || || || ||  |        | ||| || ||||        |   |     | |   | |   |          ^*****|||   | || ||| | || | ||    |  |          |  | |                     || |||    || ||||         |^*****   |  | |           ^*****|| |        |  | |  ^***** | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..             |  |         |||||| ||         | |  | |               | |     |  |         | |                 ^***           || || || ||  |        | ||| || ||||        |   |     | |   | |   |           |   ||||   | || ||| | || | ||    |  |          |  | |                     || |||    || ||||         | |       |  | |              |  || |        |  | |  |      | |
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..             |  |         |||||| ||         | |  | |               | |     |  |         | |                                || || || ||  |        | ||| || ||||        |   |     | |   | |   |           |   ||||   | || ||| | || | ||    |  |          |  | |                     || |||    || ||||         | |       |  | |              |  || |        |  | |  |      ***
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             |  |         |||||| ||         | |  | |               | |     |  |         | |                                || || || ||  |        | ||| || ||||        |   |     | |   | |   |           |   ||||   | || ||| | || | ||    |  |          |  | |                     || |||    || ||||         | |       |  | |              ***** |        |  | |  |         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..             |  |         |||||| ||         | |  | |               | |     |  |         | |                                || || || ||  |        | ||| || ||||        |   |     | |   | *****           |   ||||   | || ||| | || | ||    |  |          |  | |                     || |||    || ||||         | |       |  | |              |  || |        |  | |  |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..             |  |         |||||| ||         ***  ***               | |     |  |         | |                                || || || ||  |        | ||| || ||||        |   |     | |   | |               |   ||||   | || ||| ***| | ||    |  |          |  | |                     || |||    || ||||         ***       |  ***              |  || |        |  | |  |         
search RasMol script viewer Motif-ligand binding stats  betabulge ..             |  |         |||||| ||         | |                    | |     |  |         | |                                || || || ||  |        | ||| || ||**        |   |     | |   | |               |   ||||   | || ||| |  | | ||    |  |          |  | |                     || |||    || ||**         | |       |  |                |  || |        |  | |  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |         ||||****|         | |                    | |     |  |         | |                                ***********  |        ****| ****|          |   |     | |   | |               |   ||||   | ****|| |  | | ||    |  |          |  | |                     |****|    ****|           | |       |  |                ****| |        |  | |  |         
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |         **** |  |         ***                    ***     |  |         | |                                 |  |    |   |          ***  |  |          |   |     ***   | |               |   ****   |  | ||***  | | ||    |  |          |  | |                     |  ***     |  |           ***       |  |                    ***        |  | |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..             ****              ****                                        ****         ***                                 ****    |   |               ****          |   |           ***               |   |      |  ****  **** ****    ****          ******                     |    |     ****                     ****                               **** ****         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                                    |   |                             |   |           | |               |   |      |    |        | |                                              ******                                                                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                    |   |                             *****           | |               |   |      |    |        | |                                                                                                                                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                    *****                                             | |               *****      ******        | |                                                                                                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                      ***                                        ***                                                                                                                                       

chain B : CYANURIC ACID AMIDOHYDROLASE
JMol viewer RasMol script viewer  BR8 1366B  ..                                             *      *                              **                                                                            *                           *   *                                     **                                                                                          *                  **                   
JMol viewer RasMol script viewer  MG 1365B  ..                                             |      |                              ||                                                                            |                           |   |                                     ||                                                                                          |                  || *  * *            
sec str:  ....eeeeeeeee......hhhhhhhhhh...hhh.eeeeeeee........hhhhhhhhhhhhhhhhhhh.hhhhhhhhheeeeee........eeeeeeeee.........eeeeeeee....hhhhh.hhhhhhhhhhhhhhhhhhhh..hhh.eeeeeeee...hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh..........eeeee.......eeeeeeee......eeeeeeee....hhhhhhhhhhh.......hhh.eeeeeeee......ee..ee.........hhhhhhhhhhhhhhhhhhh....eeee..........eeeeeeee.
sequence :  ..HMYHIDVFRIPCHSPGDTSGLEDLIETGRVAPADIVAVMGKTEGNGCVNDYTREYATAMLAACLGRHLQLPPHEVEKRVAFVMSGGTEGVLSPHHTVFARRPADAHRPAGKRLTLGIAFTRDFLPEEIGRHAQITETAGAVKRAMRDAGIASIDDLHFVQVKCPLLTPAKIASARSRGCAPVTTDTYESMGYSRGASALGIALATEEVPSSMLVDESVLNDWSLSSSLASASAGIELEHNVVIAIGMSEQATSELVIAHGVMSDAIDAASVRRTIESLGIRSDDEMDRIVNVFAKAEASPDGVVRGMRHTMLSDSDINSTRHARAVTGAAIASVVGHGMVYVSGGAEHQGPAGGGPFAVIARA
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             |  ||| || || |||||| ||         | |  | |               | ||  |||  |     |   |||                 | |||| |    |  || || |  |   |        | ||| |||||||        |   | ||| |||   | |   |          |||| ||||   |  | |||||||| | ||    |  |          | || |                | |   | ||| | |||  |||       | |||   |  || || ||^***      |  | ||| |        |  |    |    | | |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..             |  ||| || || |||||| ||         | |  | |               | ||  |||  |     |   |||                 | **^* |    |  || || |  |   |        | ||| |||||||        |   | ||| |||   | |   |          |||| ||||   |  | |||||||| | ||    |  |          | || |                | |   | ||| | |||  |||       | |||   |  || || || | |      |  | ||| |        |  |    |    | | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             |  ||| || || ^**||| ||         | |  | |               | ||  |||  |     |   |||                 |  |   |    |  || || |  |   |        | ||| |||||||        |   | ^** |||   | |   |          |||| ||||   |  | |||||||| | ||    |  |          | || |                ^**   | ||| | |||  |||       | |||   |  || || || ^**      |  | ||| |        |  |    |    | | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             ^***|^*** || |||||| ||         | |  | |               | ||  |||  |     |   |||                 |  |   |    |  || || |  |   |        | ||| ^***|||        |   |  || |||   | |   |          |||| ||||   |  | |||||||| | ||    |  |          | || |                      | ||| ^***|  |||       | |||   |  || ^***|          |  | ||| |        |  |    |    | | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             |  ||  || || |||||| ||         | |  | |               | ||  |||  |     ^*****|                 |  |   ^*****  || || |  |   |        | ||| |||||||        |   |  || |||   | |   |          ^*****|||   |  | |||||||| | ||    |  |          | || |                      | ||| | | |  |||       | |^*****  || || ||          ^*****|| |        |  |    ^***** | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..             |  ||  || || |||||| ||         | |  | |               | ||  |||  |         | |                 ^***           || || |  |   |        | ||| |||||||        |   |  || |||   | |   |           ||| ||||   |  | |||||||| | ||    |  |          | || |                      | ||| | | |  |||       | |||      || || ||             |  || |        |  |           | |
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..             |  ||  || || |||||| ||         | |  | |               | ||  |||  |         | |                                || || |  |   |        | ||| |||||||        |   |  || |||   | |   |           ||| ||||   |  | |||||||| | ||    |  |          | || |                      | ||| | | |  |||       | |||      || || ||             |  || |        |  |           ***
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             |  |***** || |||||| ||         | |  | |               | |*****|  |         | |                                || || |  |   |        | ||| |||||||        |   |  || |||   | |   |           ||| ||||   |  | |||||||| | ||    |  |          | || |                      | ||| | | |  |||       | |||      ***** ||             ***** |        |  |              
search RasMol script viewer Motif-ligand binding stats  asxmotif ..             |  ||  |  || |||||| ||         | |  | |               | ||  | |  |         | |                                || || |  |   |        | ||| |||||||        |   |  || |||   | *****           ||| ||||   |  | |||||||| | ||    |  |          | || |                      | ||| | | |  |||       | |||      || || ||             |  || |        |  |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..             |  ||  |  || |||||| ||         | |  ***               | ||  | |  |         | |                                || || |  |   |        | ||| |||||||        |   |  || |||   | |               ||| ||||   |  | ||||***| | ||    |  |          | || |                      | ||| | | |  |||       | |||      || |***|             |  || |        |  |              
search RasMol script viewer Motif-ligand binding stats  betabulge ..             |  ||  |  || |||||| ||         | |                    | ||  | |  |         | |                                || || |  |   |        | ||| |||||**        |   |  || |||   | |               ||| ||||   |  | |||||| | | ||    |  |          | || |                      | ||| | | |  |**       | |||      || ||  |             |  || |        |  |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ********  |****||****|         | |                    | |**** |  |         | |                                *******  |   |        ****| *****          |   |  |****|   | |               ||****||   |  | |||||| | | ||    |  |          | || |                      ****| | | ****         ****|      ****|  |             ****| |        |  |              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             |  |      |  |||| |  |         | |                    | |     |  |         | |                                 |  |    |   |          | | ||| |          |   |  |  | |   | |               ||  ||||   |  | |||*** | | ||    |  |          | || |                        | | | | |  |           | |       |  |  |                 | |        |  |              
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |      |  **** |  |         ***                    ***     |  |         | |                                 |  |    |   |          *** ||| |          |   |  |  ***   | |               ||  ****   |  | ||***  | | ||    |  |          | || |                        *** | | |  |           ***       |  |  |                 ***        |  |              
search RasMol script viewer Motif-ligand binding stats  niche ..             ****      |    |  ****                                        ****         ***                                 ****    |   |              |****          |   |  |    |   ***               ||  | |    |  ****  **** ****    ****          ******                            | | ****                     *******                            ****              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                       ******                                                                                                       |   |              | | |          |   |  ******                     |******    |    |        | |                   | |                               | |                                                                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                    |   |              *****          *****                             |   |      |    |        | |                   | |                               | |                                                                               
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                    *****              | |                                              *****      ******        | |                   | |                               | |                                                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                       ***                                                                       ***                   ***                               ***                                                                               

   New search    3zgu:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML