triangle PDBeMotif: 3s8r  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.5.1.93
Classification hydrolase    | release date: Mon, May 30, 2011
Title crystal structures of glutaryl 7-aminocephalosporanic acid a insight into autoproteolytic activation
Authors I.S.YANG, J.K.KIM, K.H.KIM, S.S.PARK
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
EPTSTPQAPIAAYKPRSNEILWDGYGVPHIYGVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWL
LTNGVPERAQQWYAQQSPDFRANLDAFAAGINAYAQQNPDDISPDVRQVLPVSGADVVAHAHRLMNFLYVASPGRTLGEG
DPPDLADQGANSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEAHLVTPDFEIYGATQIGLPVIRFAFNQRMGITNTVN
GMVGATNYRLTLQDGGYLYDGQVRPFERPQASYRLRQADGTTVDKPLEIRSSVHGPVFERADGTAVAVRVAGLDRPGMLE
QYFDMITADSFDDYEAALARMQVPTFNIVYADREGTINYSFNGVAPKRAEGDIAFWQGLVPGDSSRYLWTETHPLDDLPR
VTNPPGGFVQNSNDPPWTPTWPVTYTPKDFPSYLAPQTPHSLRAQQSVRLMSENDDLTLERFMALQLSHRAVMADRTLPD
LIPAALIDPDPEVQAAARLLAAWDREFTSDSRAALLFEEWARLFAGQNFAGQAGFATPWSLDKPVSTPYGVRDPKAAVDQ
LRTAIANTKRKYGAIDRPFGDASRMILNDVNVPGAAGYGNLGSFRVFTWSDPDENGVRTPVHGETWVAMIEFSTPVRAYG
LMSYGNSRQPGTTHYSDQIERVSRADFRELLLRREQVEAAVQERTPFNFKPHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GLUTARYL-7-AMINOCEPHALOSPORANIC-ACID ACYLASE
member of: CATH:search1.10.1400.10/search1.10.439.10/search3.60.20.10GENE3D:searchG3DSA_1.10.439.10/searchG3DSA_2.30.120.10/searchG3DSA_3.60.20.10PFAM:searchPF01804SUPERFAMILY:searchSSF56235UniProt:searchP07662
JMol viewer RasMol script viewer  GOL 698A  ..                                                                      *                                                                       *    *          **                                 *                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          
sec str:  ...............eeeee....eeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhh....hhhhhh.eeeeeee.hhhh.....eeeeeeeee..hhhh.eeeeeee....eeeeeee.......eee...eeeeee......eeeee..ee..eeee..eee.....eeeeeee.....eeeeeee........eee.....eeeeee......hhhhhhhhhhh..hhhhhhhhhh.......eeeeee....eeeee..........hhhhhhh.ee..hhhhh.....hhhhh.eee.....eeee..............hhhhh..........hhhhhhhhhhhhh....hhhhhhhhhh...hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.........hhhhhhhhhhhhhh........eee...........eee.hhhhhhhhhhhhhhhhhhhhh....hhhhhheeee..eeee....hhhhh....eee..........eeeee.eeeeee.....eeeeee...............hhhhhhh...ee...hhhhhhhheeeeee...
sequence :  ..PQAPIAAYKPRSNEILWDGYGVPHIYGVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANLDAFAAGINAYAQQNPDDISPDVRQVLPVSGADVVAHAHRLMNFLYVASPGRTLGEGDPPDLADQGANSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEAHLVTPDFEIYGATQIGLPVIRFAFNQRMGITNTVNGMVGATNYRLTLQDGGYLYDGQVRPFERPQASYRLRQADGTTVDKPLEIRSSVHGPVFERADGTAVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALARMQVPTFNIVYADREGTINYSFNGVAPKRAEGDIAFWQGLVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSNDPPWTPTWPVTYTPKDFPSYLAPQTPHSLRAQQSVRLMSENDDLTLERFMALQLSHRAVMADRTLPDLIPAALIDPDPEVQAAARLLAAWDREFTSDSRAALLFEEWARLFAGQNFAGQAGFATPWSLDKPVSTPYGVRDPKAAVDQLRTAIANTKRKYGAIDRPFGDASRMILNDVNVPGAAGYGNLGSFRVFTWSDPDENGVRTPVHGETWVAMIEFSTPVRAYGLMSYGNSRQPGTTHYSDQIERVSRADFRELLLRREQVEAAVQERTPFNF
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                 | | |                     |  |      || ||||    |  |    | ||||||       |  ||   |                || ||    |  |  |  ||                |||||||   |  |  |      |  | | |       | | |||  |  |    | ||      |  |       | |||    ||||   |    | || |               | |  | |||  |               | |||   |   | |        | | || |  ||     ||||          | | ^***          |   | |  | |||| |      |  |     | |||    | | |        ||||| |  |     | | | ||| || || |      || || || ||| |  |    |  | | |       |  || | |  |              | |||||  | |  | |||                   |   | | | |  || ||||   || |        | |||||  |  | | |||      |                      | |  | |       |||||    | |   || ||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                 | | |                     |  |      || ||||    |  |    | ||||||       |  ||   |                || ||    |  |  |  ||                |||||||   |  |  |      |  | | |       | | |||  |  |    | ||      |  |       | |||    ||||   |    | || |               ^**  | |||  |               | |||   |   | |        | | || |  ||     ||||          | |               |   | |  | |^** |      |  |     | |||    | | |        ^**|| |  |     ^** | ^** || || |      || |^**| ||| |  |    |  | | |       |  || | |  |              | |||||  | |  | |||                   |   ^** | |  || ||||   || |        | ||^**  |  | | |||      |                      | |  | |       |||||    | |   || ||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 | | |                     ^***      || ||||    |  |    | ||||||       |  ||   |                || ||    |  |  ^***|                ||^***|   |  |  |      |  | | |       | | |||  ^***    | ||      |  |       | |||    ||||   |    ^*** |                    | ||^***               | |||   |   | |        | | || ^***|     ||||          | |               |   | |  | |||  |      |  |     | |||    | | |        ^***| |  |     |   |  |  |^*** |      || ||  | ||| ^***    |  | | |       |  || | |  |              | |||||  | |  | |||                   |   |   | |  || ||||   || |        | ||||   ^*** | |||      |                      | |  | |       |^***    | |   || ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 | | |                               || ||||    |  |    | ||||||       |  ||   |                || ||    |  |  |   |                || ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       | ||^*****|^*****      |  |                    | |||                  | |^*****   | |        | | || |   |     ||||          | |               |   | ^*****||  |      |  |     | |||    | | |         |  | |  |     |   |  |  || |  |      || ||  | ||| |       |  | | |       |  || | |  |              ^*****|  | |  | |||                   |   |   | |  || ||||   || |        ^*****        | |||      |                      | |  | |       | |||    | |   || ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 | | |                               || ||||    |  |    | ||||||       |  ||   |                || ||    |  |  |   |                || ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       | ||     || |          |  |                    | |||                  | |||       | |        | | || |   |     ||||          | |               |   |    |  ||  |      |  |     | |||    | | |         |  | |  |     |   |  |  || |  |      || ||  ***** |       |  | | |       |  || | |  |              | |||||  | |  | |||                   |   |   | |  |*****|   || |        | |||         | |||      |                      | |  | |       | |||    | |   *****        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                 | | |                               || ||||    |  |    | ||||||       |  ||   |                || ||    |  |  |   |                || ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       | ||     || |          |  |                    | |||                  | |||       | |        | | || |   |     ||||          | |               *****    |  ||  |      |  |     | |||    | | |         |  | |  |     |   |  |  || |  |      || ||  | ||  |       |  | | |       |  || | |  |              | |||||  | |  | |||                   |   |   | |  || || |   || |        | |||         *****      |                      | |  | |       | |||    | |   || ||        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 *** |                               || ||||    |  |    | ||||||       |  ||   |                || ||    |  |  |   |                || ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       ***|     || |          |  |                    | |||                  | ***       | |        | | || |   |     ||||          | |                        |  ||  |      |  |     | |||    | | |         |  | |  |     |   |  |  || |  |      || ||  | ||  |       |  | ***       |  || | |  |              | |||||  | |  | |||                   |   |   | |  || || |   || |        | |||         ***||      |                      | |  | |       | |||    | |   || ||        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                   | |                               || ||||    |  |    | ||||||       |  ||   |                || ||    |  |  |   |                || ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       |  |     || |          |  |                    *****                  *****       | |        | | || |   |     ||||          | |                        |  ||  |      |  |     | |||    | | |         |  | |  |     |   |  |  || |  |      || ||  | ||  |       |  | |         |  || | |  |              | |||||  | |  | |||                   |   |   | |  || || |   || |        | |||         *****      |                      | |  | |       | |||    | |   || ||        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   | |                               |****||    ****    | |****|       |  ||   |                ****|    |  |  |   |                |****||   |  |  |      **** | |       | | ||****       | ||      ****       |  |     || |          ****                    ****|                  ****|       | |        | | || |   |     ||||          | |                        |  ||  |      ****     ****|    | | |         |  | |  |     |   |  |  || |  |      ****|  ****  |       |  | |         |  || | |  |              ****|||  | |  ****|                   |   |   | |  |**** |   ****        ****|         ****|      |                      | **** |       ****|    | |   ****|        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | |                               |  ||||            | | || |       |  ||   |                 |  |    |  |  |   |                |  ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       |  |     || |                                    | |                    | |       | |        | | || |   |     ||||          | |                        |  ||  |      |  |       | |    | ***         |  | |  |     |   |  |  || |  |       |  |    |   |       |  | |         |  || | |  |                |||||  | |  | | |                   |   |   | |  |  |  |    | |          | |           | |      |                      | |  | |         | |    | |    |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***                               |  ****            | | |***       |  ||   |                 |  |    |  |  |   |                |  ****   |  |  |      |  | ***       | | |||  |       | ||      |  |       |  |     |***                                    ***                    ***       ***        | | || |   |     ****          ***                        |  ||  |      |  |       ***    |             |  | |  |     |   |  |  || |  |       |  |    |   |       |  | |         |  |*** |  |                ****|  | |  | | |                   |   |   ***  |  |  |    | |          ***           ***      |                      | |  | |         ***    | |    |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                     |    |             | | |  |       ****|   |                 ****    ****  |   |                |    |    ****  |      ****           | ********       ****      ****       ****     |                                                                                   | **** |   |      ***                                     ********      ****              |             **** ****     |   |  |  *******       ****    |   |       ******         ****    ****                 *********  | | |                   |   |     ****  ****    ***                                 |                      ****** |                ***    ****        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                     ******             | ******           |   |                               |   |                ******          |                     | | |            | |                           |                                                                                   |   |  |   |                                                                              |                           |   |  |   |                    |   |                                                              | | |                   |   |                                                       |                           | |                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                        |   |              *****                               *****                                |                     | | |            | |                           |                                                                                   |   |  *****                                                                              |                           *****  |   |                    |   |                                                              *****                   |   |                                                       |                           | |                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                        *****                                                                                       |                     | | |            | |                           |                                                                                   *****                                                                                     |                                  *****                    *****                                                              | |                     *****                                                       |                           | |                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                    |                     | ***            ***                           |                                                                                                                                                                             |                                                                                                                              ***                                                                                 |                           ***                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                    *                     *                                              *                                                                                                                                                                             *                                                                                                                                                                                                                  *                                                                 

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : GLUTARYL-7-AMINOCEPHALOSPORANIC-ACID ACYLASE
member of: CATH:search1.10.1400.10/search1.10.439.10/search3.60.20.10GENE3D:searchG3DSA_1.10.439.10/searchG3DSA_2.30.120.10/searchG3DSA_3.60.20.10PFAM:searchPF01804SUPERFAMILY:searchSSF56235UniProt:searchP07662
JMol viewer RasMol script viewer  GOL 698B  ..                                                                      *                                                                  *    *    *                                             *                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            
sec str:  ...............eeeee....eeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhh....hhhhhh.eeeeeee.hhhh.....eeeeeeeee..hhhh.eeeeeee....eeeeeee.......eee...eeeeee......eeeee.eee..eeee..eee.....eeeeeee.....eeeeeee........eee.....eeeeee......hhhhhhhhhhh..hhhhhhhhhh.......eeeeee....eeeee..........hhhhhhh.ee..hhhhh.....hhhhh.eee.....eee...............hhhhh..........hhhhhhhhhhhhh....hhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.........hhhhhhhhhhhhh.........eee...........eee.hhhhhhhhhhhhhhhhhhhhh....hhhhhheeee..eeee....hhhhh....eee..........eeeee.eeeeee.....eeeeee...............hhhhhhh...ee...hhhhhhhheeeeee.....
sequence :  ..PQAPIAAYKPRSNEILWDGYGVPHIYGVDAPSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANLDAFAAGINAYAQQNPDDISPDVRQVLPVSGADVVAHAHRLMNFLYVASPGRTLGEGDPPDLADQGANSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEAHLVTPDFEIYGATQIGLPVIRFAFNQRMGITNTVNGMVGATNYRLTLQDGGYLYDGQVRPFERPQASYRLRQADGTTVDKPLEIRSSVHGPVFERADGTAVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALARMQVPTFNIVYADREGTINYSFNGVAPKRAEGDIAFWQGLVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSNDPPWTPTWPVTYTPKDFPSYLAPQTPHSLRAQQSVRLMSENDDLTLERFMALQLSHRAVMADRTLPDLIPAALIDPDPEVQAAARLLAAWDREFTSDSRAALLFEEWARLFAGQNFAGQAGFATPWSLDKPVSTPYGVRDPKAAVDQLRTAIANTKRKYGAIDRPFGDASRMILNDVNVPGAAGYGNLGSFRVFTWSDPDENGVRTPVHGETWVAMIEFSTPVRAYGLMSYGNSRQPGTTHYSDQIERVSRADFRELLLRREQVEAAVQERTPFNFKP
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                 | |||      |   |          |  |      || ||||    |  |      || |||       |  ||   |                 |  |    |  |  | ||                   |||||   |  |  |      |  | | |       | | |||  |  |    | ||      |  |       | |||    ||||   |    |  |                 | |  | |||  |               | |||   |   | |        | | || |  ||  |  ||||          | | ^***                |  | |||| |      |  |       | |    | | |        ||||| |  || |  | |   ||| || ||  |   |  |  | || ||| |  |    |  | |         |  || | |  |              | |||||  |    | | |  |                |   | | | |  || ||||   || |        | |||||  |  | | |||      |                      | |  | |      ||||||    | |    |  |||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                 | |||      |   |          |  |      || ||||    |  |      || |||       |  ||   |                 |  |    |  |  | ||                   |||||   |  |  |      |  | | |       | | |||  |  |    | ||      |  |       | |||    ||||   |    |  |                 ^**  | |||  |               | |||   |   | |        | | || |  ||  |  ||||          | |                     |  | |^** |      |  |       | |    | | |        ^**|| |  || |  ^**   ^** || ||  |   |  |  ^**| ||| |  |    |  | |         |  || | |  |              | |||||  |    | | |  |                |   ^** | |  || ||||   || |        | ||^**  |  | | |||      |                      | |  | |      ||||||    | |    |  |||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 | |||      |   |          ^***      || ||||    |  |      || |||       |  ||   |                 |  |    |  |  ^***                   ^***|   |  |  |      |  | | |       | | |||  ^***    | ||      |  |       | |||    ||||   |    ^***                      | ||^***               | |||   |   | |        | | || ^***|  |  ||||          | |                     |  | |||  |      |  |       | |    | | |        ^***| |  || |         |  |^***  |   |  |  |  | ||| ^***    |  | |         |  || | |  |              | |||||  |    | | |  |                |   |   | |  || ||||   || |        | ||||   ^*** | |||      |                      | |  | |      ||^***    | |    |  |||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 | |||      |   |                    || ||||    |  |      || |||       |  ||   |                 |  |    |  |  | |                     ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       | ||^*****|^*****                              | |||                  | |^*****   | |        | | || |   |  |  ||||          | |                     ^*****||  |      |  |       | |    | | |         |  | |  || |         |  || |   |   |  |  |  | ||| |       |  | |         |  || | |  |              ^*****|  |    | | |  |                |   |   | |  || ||||   || |        ^*****        | |||      |                      | |  | |      || |||    | |    |  |||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 | |||      |   |                    || ||||    |  |      || |||       |  ||   |                 |  |    |  |  | |                     ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       | ||     || |                                  | |||                  | |||       | |        | | || |   |  |  ||||          | |                        |  ||  |      |  |       | |    | | |         |  | |  || |         |  || |   |   |  |  |  ***** |       |  | |         |  || | |  |              | |||||  |    | | |  |                |   |   | |  |*****|   || |        | |||         | |||      |                      | |  | |      || |||    | |    |  |||        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                 *****      *****                    || ||||    |  |      || |||       |  ||   |                 |  |    |  |  | |                     ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       | ||     || |                                  | |||                  | |||       | |        | | || |   |  |  ||||          | |                        |  ||  |      |  |       | |    | | |         |  | |  || |         |  || |   |   |  |  |  | ||  |       |  | |         |  || | |  |              | |||||  |    | | |  |                |   |   | |  || || |   || |        | |||         *****      |                      | |  | |      || |||    | |    |  |||        
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 ***||                               || ||||    |  |      || |||       |  ||   |                 |  |    |  |  | |                     ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       ***|     || |                                  | |||                  | ***       | |        | | || |   |  |  ||||          | |                        |  ||  |      |  |       | |    | | |         |  | |  || |         |  || |   |   |  |  |  | ||  |       |  ***         |  || | |  |              | |||||  |    | | |  |                |   |   | |  || || |   || |        | |||         ***||      |                      | |  | |      || |||    | |    |  |||        
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 | |||                               || ||||    |  |      || |||       |  ||   |                 |  |    |  |  | |                     ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       |  |     || |                                  | |||                  | |||       | |        | | || |   |  |  ||||          | |                        |  ||  |      |  |       | |    | | |         |  | |  || |         |  || |   |   |  |  |  | ||  |       |  | |         |  || | |  |              | |||||  |    | | |  |                |   |   | |  || || |   || |        | |||         | |||      |                      | |  | |      || |||    | |    |  |**        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                 *****                               || ||||    |  |      || |||       |  ||   |                 |  |    |  |  | |                     ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       |  |     || |                                  *****                  *****       | |        | | || |   |  |  ||||          | |                        |  ||  |      |  |       | |    | | |         |  | |  || |         |  || |   |   |  |  |  | ||  |       |  | |         |  || | |  |              | |||||  |    | | |  |                |   |   | |  || || |   || |        | |||         *****      |                      | |  | |      || |||    | |    |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 ****|                               |****||    ****      |****|       |  ||   |                 |  |    |  |  | |                     ||||   |  |  |      **** | |       | | ||****       | ||      ****       |  |     || |                                  ****|                  ****|       | |        | | || |   |  ****|||          | |                        |  ||  |      |  |       | |    | | |         |  | |  || |         |  || |   |   |  |  |  ****  |       |  | |         |  || | |  |              ****|||  |    | | |  |                |   |   | |  |**** |   ****        ****|         ****|      |                      | **** |      |****|    | |    |  |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   | |                               |  ||||              |  | |       |  ||   |                 |  |    |  |  | |                     ||||   |  |  |      |  | | |       | | |||  |       | ||      |  |       |  |     || |                                    | |                    | |       | |        | | || |   |     ||||          | |                        |  ||  |      |  |       | |    | ***         |  | |  || |         |  || |   |   |  |  |    |   |       |  | |         |  || | |  |                |||||  |    | | |  |                |   |   | |  |  |  |    | |          | |           | |      |                      | |  | |      |  | |    | |    |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..                   ***                               |  ****              |  ***       |  ||   |                 |  |    |  |  | |                     ****   |  |  |      |  | ***       | | |||  |       | ||      |  |       |  |     |***                                    ***                    ***       ***        | | || |   |     ****          ***                        |  ||  |      |  |       ***    |             |  | |  || |         |  || |   |   |  |  |    |   |       |  | |         |  |*** |  |                ****|  |    | | |  |                |   |   ***  |  |  |    | |          ***           ***      |                      | |  | |      |  ***    | |    |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                                     |    |               |    |       ****|   |                 ****    ****  | |                            ****  |      ****           | ********       ****      ****       ****     |                                                                                   | **** |   |      ***                                     ********      ****              |             **** *******         |  ****   |   |  ****    |   |       ******         ****    ****                 *******    | | ****                |   |     ****  ****    ***                                 |                      ****** |      |    |    ***    ****          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                     ******               ******           |   |                               | |                                  |                     | | ||   |       | |                           |                                                                                   |   |  |   |                                                                              |                                  |   |     |   |          |   |                                                              | |                     |   |                                                       |                           | |      ******                         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                           *****                               | |                                  |                     | | ||   |       | |                           |                                                                                   |   |  *****                                                                              |                                  |   |     *****          |   |                                                              | |                     |   |                                                       |                           | |                                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                               | |                                  |                     | | |*****       | |                           |                                                                                   *****                                                                                     |                                  *****                    *****                                                              | |                     *****                                                       |                           | |                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                               ***                                  |                     | ***            ***                           |                                                                                                                                                                             |                                                                                                                              ***                                                                                 |                           ***                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                    *                     *                                              *                                                                                                                                                                             *                                                                                                                                                                                                                  *                                                                   

   New search    3s8r:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors