triangle PDBeMotif: 3q29  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification sugar binding protein, protein fibril    | release date: Sun, Dec 19, 2010
Title cyrstal structure of human alpha-synuclein (1-19) fused to m binding protein (mbp)
Authors D.CASCIO, D.EISENBERG, M.R.SAWAYA, M.ZHAO
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search MAL MAL binding statistics MAL   search SO4 SO4 binding statistics SO4   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C sequence:
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEI
TPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWP
LIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSK
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAA
TMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSMDVFMKGLSKAKEGVVAAA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MALTOSE-BINDING PERIPLASMIC PROTEIN/ALPHA-SYNUCLECHIMERIC PROTEIN;
JMol viewer RasMol script viewer  SO4 395C  ..                                                                                                                                                                                                         *                                                                                                                                                                                   
JMol viewer RasMol script viewer  GOL 396A  ..                                                                                                                                                   *                                                     |         *  **  * *                                                                                                                                                                
JMol viewer RasMol script viewer  GOL 1A  ..                                                                                                                                                   |                                                     |         |  ||  | |                                                                                                                ** **                                           
JMol viewer RasMol script viewer  SO4 395A  ..                **                                                                                                                                 |                                                     |         |  ||  | |                                                                                                                || ||                                           
JMol viewer RasMol script viewer  SO4 394A  ..                ||                                                                                                                                 |                                     *               |         |  ||  | |                                                                                                                || ||                                           
JMol viewer RasMol script viewer  SO4 393A  ..                ||                                                               **                                                                |                                     |               |         |  ||  | |                                                                                                                || ||                                           
JMol viewer RasMol script viewer  SO4 392A  ..                ||                     **    *                                   ||                                                                |                                     |               |         |  ||  | |                                                                                                                || ||                                           
JMol viewer RasMol script viewer  SO4 391A  ..                ||                     ||    |                                   ||                                                                | * **                                |               |      ** |  ||  | |                                                                                                                || ||                                           
JMol viewer RasMol script viewer  MAL 5044A  ..             ** ||                     ||    |               ** **               ||                           *                                    | | |****                             |               |      || |  ||  | |        *                                                                                                       || || *                                         
sec str:  ........eeee.....hhhhhhhhhhhhhh.....eeee...hhhhhhhhhhhhh....eeeee..hhhhhhhh........hhhhhh..hhhhhhhhee..ee..eeeeee..eeeee.........hhhhhhhhhhhhhh...eee.....hhhhhhhhhhhh..eeeeee..eeeeeeee..hhhhhhhhhhhhhhhhh.......hhhhhhhhhhh..eeeeeehhhhhhhhhhhh..eeee...ee..ee...eeeeeeeee.....hhhhhhhhhhhh..hhhhhhhhhhhh...ee.hhhhhhhhhhhhhhhhhhhhhhhhee.....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSMDVFMKGLSKA
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372        
search RasMol script viewer Motif-ligand binding stats  PS00001 ..  |  |     |  |      || ||    |||   |    | |        | |               | ||||     || || |||    |  |        |||        | |   |   |  |       || |||     | ||        | |||               |  | | |   |    || ||||| ||  |  |    ||||          |  |||||        ||| |      |    | | || |           | |               | | |  | |  | |   |          | |                  |||||  ||    ||^*** |   || |  
search RasMol script viewer Motif-ligand binding stats  PS00005 ..  |  |     |  |      || ||    |||   |    | |        | |               | ||||     || || |||    |  |        |||        | |   |   |  |       || |||     | ||        | |||               |  | | |   |    || ||||| ||  |  |    ||||          |  |^**|        ^** |      |    | | || |           | |               | | |  | |  | |   |          | |                  ^**||  ||    ||  |  |   || |  
search RasMol script viewer Motif-ligand binding stats  PS00006 ..  |  |     |  |      || ||    |||   |    | |        | |               | ||||     || || |||    |  |        |||        | |   |   ^***       || |||     | ||        | |||               |  | | |   |    || ||||| ||  ^***    ||||          ^*** |||         |  |      |    | | || |           | |               | | ^*** |  | |   |          | |                  ||||^***|    ||  ^***   || |  
search RasMol script viewer Motif-ligand binding stats  PS00007 ..  |  |     |  |      || ||    |||   |    | |        | |               | ||||     |*******^    |  |        |||        | |   |              || |||     | ||        | |||               |  | | |   |    || ||||| ||          ||||             | |||         |  |      |    | | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      || |  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..  |  |     |  |      || ||    |^*****    | |        | |               | ||||     |  || ||     |  |        |||        | |   |              || |||     | ||        | |||               ^***** |   |    || ||||| ||          ||||             | |||         |  |      ^***** | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |^****
search RasMol script viewer Motif-ligand binding stats  PS00009 ..  |  |     |  |      |^***    | |        | |        | |               | ||||     |  || ||     |  |        |||        | |   |              || |||     | ||        | |||               |  |   |   |    || ||||| ||          ||||             | |||         |  |             | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  PS01037 ..  |  |     |  |      |  ||    | |        | |        | |               | ||||     |  || ||     |  |        ******************              || |||     | ||        | |||               |  |   |   |    || ||||| ||          ||||             | |||         |  |             | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |     |  |      *****    | |        | |        | |               | ||||     |  || ||     |  |         ||        | |                  || |||     | ||        | |||               |  |   |   |    || ||||| ||          ||||             | |||         |  |             | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |     |  |      |  |     | |        | |        | |               | ||||     ***** ||     |  |         ||        | |                  || |||     | ||        | |||               |  *****   |    || ||||| ||          ||||             | |||         |  |             | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |     |  |      |  |     | |        | |        | |               | ||||        || ||     |  |         ||        ***                  || |||     ***|        | |||               |  |   |   |    || ||||***|          ||||             | |||         |  |             ***| |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  |     |  |      |  |     | |        | |        | |               | ||||        || ||     |  |         **                             || |||     |  |        | |||               |  |   |   |    || |||||  |          ||||             | |||         |  |             |  | |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |     |  |      ****     | |        | |        | |               ****||        ****|     |  |                                        *****|     |  |        ****|               |  |   |   |    |****|||  |          ||||             ****|         ****             |  | |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      ****  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |     |  |               | |        | |        | |                 ||||         |  |     |  |                                        |  | |     |  |          | |               |  |   |   |    |  |||||  |          ||||               | |                          |  | |           ***               | |      |  | |   |          | |                  |||||   |    ||  |            
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |     |  |               ***        ***        ***                 ****         |  |     |  |                                        |  ***     |  |          ***               |  |   |   |    |  ****|  |          ****               ***                          |  | |                             | |      |  | |   |          | |                  ****|   |    ||  |            
search RasMol script viewer Motif-ligand binding stats  niche ..  ****     ****               | |                                                    ****     ****                                        |    |     ****                            ****   |   |    |    | ****                             | |                          **** |                             ***      **** |   |          ***                      |   |    |****            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                              | |                                                                                                         ******                                            |   |    ******                                  | |                             | |                                           |   |                                   |   |    |   |            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                              | |                                                                                                                                                           |   |                                            | |                             | |                                           |   |                                   *****    |   |            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              | |                                                                                                                                                           *****                                            | |                             | |                                           *****                                            *****            
search RasMol script viewer Motif-ligand binding stats  stturn ..                              ***                                                                                                                                                                                                            ***                             ***                                                                                                             

chain C : MALTOSE-BINDING PERIPLASMIC PROTEIN/ALPHA-SYNUCLECHIMERIC PROTEIN;
JMol viewer RasMol script viewer  GOL 397C  ..                                                                                                                                                                                                                                                                                                                                *   *                                                           
JMol viewer RasMol script viewer  GOL 396C  ..                                                                                                                      *                                                                                                                           **                                                                            |   |                                                           
JMol viewer RasMol script viewer  SO4 394C  ..                                                                                                                      |                                                                                                                           ||                                                                    *       |   |                                                           
JMol viewer RasMol script viewer  SO4 393C  ..                                                                                 **                                   |                                                                                                                           ||                                                                    |       |   |                                                           
JMol viewer RasMol script viewer  SO4 392C  ..                **                                                               ||                                   |                                                                                                                           ||                                                                    |       |   |                                                           
JMol viewer RasMol script viewer  SO4 391C  ..                ||                     **                                        ||                                   |                                                                                                                           ||                                                                    |       |   |                                                           
JMol viewer RasMol script viewer  SO4 1C  ..                ||                     ||                                        ||                                   |                              * *                                                        **                                ||                                                                    |       |   |                                                           
JMol viewer RasMol script viewer  MAL 5044C  ..             ** ||                     ||                    ** **               ||                           *       |                              | |****                                                    ||                   *            ||                                                                    |       |   |              *                                            
sec str:  ........eeee.....hhhhhhhhhhhhhhhhh..eeee...hhhhhhhhhhh......eeeee..hhhhhhhh........hhhhhh..hhhhhhhhee..ee..eeeeee..eeeee............hhhhhhhhhhh...eee.....hhhhhhhhhhhh..eeeeee..eeeeeeee..hhhhhhhhhhhhhhhhh.......hhhhhhhhhhh..eeeeeehhhhhhhhhhhh..eeee............eeeeeeeee.....hhhhhhhhhhhh..hhhhhhhhhhhh...ee.hhhhhhhhh.hhhhhhhhhhhhhhee.....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhh...
sequence :  ..KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSMDVFMKGLSKAKEG
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..  |  |     |  |       |  ||   |||   |    | |||    | |||               | ||||      | || |||  ||| |||  |    |                |   |  |       || |||     |  |          | |     |  |      |    | |   |       ||||| ||  |  |    ||||          |  |||||        ||| |      |    | |  | |           | |               | | |  | |  | |              | |              |   |||||  |    | |^*** |    |    | |
search RasMol script viewer Motif-ligand binding stats  PS00005 ..  |  |     |  |       |  ||   |||   |    | |||    | |||               | ||||      | || |||  ||| |||  |    |                |   |  |       || |||     |  |          | |     |  |      |    | |   |       ||||| ||  |  |    ||||          |  |^**|        ^** |      |    | |  | |           | |               | | |  | |  | |              | |              |   ^**||  |    | | ||  |    |    | |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..  |  |     |  |       |  ||   |||   |    | |||    | |||               | ||||      | || |||  ||| |||  |    |                |   ^***       || |||     |  |          | |     |  |      |    | |   |       ||||| ||  ^***    ||||          ^*** | |         |  |      |    | |  | |           | |               | | ^*** |  | |              | |              |   ||||^***    | | |^***    |    | |
search RasMol script viewer Motif-ligand binding stats  PS00007 ..  |  |     |  |       |  ||   |||   |    | |||    | |||               | ||||      *******^  ||| |||  |    |                |              || |||     |  |          | |     |  |      |    | |   |       ||||| ||          ||||               | |         |  |      |    | |  | |           | |               | |      |  | |              | |              |   ||||        | | ||       |    | |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..  |  |     |  |       |  ||   |^*****    | |||    | |||               | ||||        || |||  ||| |||  |    |                |              || |||     |  |          | |     |  |      ^***** |   |       ||||| ||          ||||               | |         |  |      ^***** |  | |           | |               | |      |  | |              | |              |   ||||        | | ||       ^***** ^
search RasMol script viewer Motif-ligand binding stats  PS00009 ..  |  |     |  |       ^***|   | |        | |||    | |||               | ||||        || |||  ||| |||  |    |                |              || |||     |  |          | |     |  |             |   |       ||||| ||          ||||               | |         |  |             |  | |           | |               | |      |  | |              | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  PS01037 ..  |  |     |  |           |   | |        | |||    | |||               | ||||        || |||  ||| |||  |    ******************              || |||     |  |          | |     |  |             |   |       ||||| ||          ||||               | |         |  |             |  | |           | |               | |      |  | |              | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |     |  |           |   | |        *****    | |||               | ||||        || |||  ||| |||  |                                    || |||     |  |          | |     |  |             |   |       ||||| ||          ||||               | |         |  |             |  | |           | |               | |      |  | |              | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |     |  |           |   | |        | ||     | |||               | ||||        || |||  ||| |||  |                                    || |||     |  |          | |     |  |             |   |       ||||***|          ||||               | |         |  |             |  | |           | |               | |      |  ***              | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |     |  |           |   | |        ****     ****|               ****||        ****|********|****                                    *****|     |  |          | |     ****             |   |       |||||  |          ||||               | |         ****             **** |           | |               | |      |  |                | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |     |  |           |   | |        | |        | |                 ||||         |  |     |  |                                        |  | |     |  |          | |                      |   |       |||||  |          ||||               | |                          |  | |           ***               | |      |  |                | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |     |  |           |   ***        ***        ***                 ****         |  |     |  |                                        |  ***     |  |          ***                      |   |       ****|  |          ****               ***                          |  | |                             | |      |  |                | |              |   ****        | | ||               
search RasMol script viewer Motif-ligand binding stats  niche ..  ****     ****           |   | |                                                    ****     ****                                        |    |     ****                                   |   |           ****                             | |                          **** |                             ***      ****                ***              |   |           | ****               
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                          |   | |                                                                                                         ******                                            |   |                                            | |                             | |                                                                           |   |           |   |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                          ***** |                                                                                                                                                           *****                                            | |                             | |                                                                           *****           *****                
search RasMol script viewer Motif-ligand binding stats  stturn ..                              ***                                                                                                                                                                                                            ***                             ***                                                                                                                

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MALTOSE-BINDING PERIPLASMIC PROTEIN/ALPHA-SYNUCLECHIMERIC PROTEIN;
JMol viewer RasMol script viewer  GOL 397C  ..                                                                                                                                                                                                                                                                                                                                                                             *       *       
JMol viewer RasMol script viewer  GOL 396C  ..                                                                                                                                                                                                                                                                                                                                                                  *          |       |       
JMol viewer RasMol script viewer  SO4 395C  ..                                                                                                                                                                                                         *                                                                                                                                                        |          |       |       
JMol viewer RasMol script viewer  SO4 394C  ..                                                                                                                                                                                                         |                                                                                                                                             *          |          |       |       
JMol viewer RasMol script viewer  GOL 396A  ..                                                                                                                                                   *                                                     |         *  **  * *                                                                                                                          |          |          |       |       
JMol viewer RasMol script viewer  GOL 1A  ..                                                                                                                                                   |                                                     |         |  ||  | |                                                                                                                ** **     |          |          |       |       
JMol viewer RasMol script viewer  SO4 395A  ..                **                                                                                                                                 |                                                     |         |  ||  | |                                                                                                                || ||     |          |          |       |       
JMol viewer RasMol script viewer  SO4 394A  ..                ||                                                                                                                                 |                                     *               |         |  ||  | |                                                                                                                || ||     |          |          |       |       
JMol viewer RasMol script viewer  SO4 393A  ..                ||                                                               **                                                                |                                     |               |         |  ||  | |                                                                                                                || ||     |          |          |       |       
JMol viewer RasMol script viewer  SO4 392A  ..                ||                     **    *                                   ||                                                                |                                     |               |         |  ||  | |                                                                                                                || ||     |          |          |       |       
JMol viewer RasMol script viewer  SO4 391A  ..                ||                     ||    |                                   ||                                                                | * **                                |               |      ** |  ||  | |                                                                                                                || ||     |          |          |       |       
JMol viewer RasMol script viewer  MAL 5044A  ..             ** ||                     ||    |               ** **               ||                           *                                    | | |****                             |               |      || |  ||  | |        *                                                                                                       || || *   |          |          |       |       
sec str:  ........eeee.....hhhhhhhhhhhhhh.....eeee...hhhhhhhhhhhhh....eeeee..hhhhhhhh........hhhhhh..hhhhhhhhee..ee..eeeeee..eeeee.........hhhhhhhhhhhhhh...eee.....hhhhhhhhhhhh..eeeeee..eeeeeeee..hhhhhhhhhhhhhhhhh.......hhhhhhhhhhh..eeeeeehhhhhhhhhhhh..eeee...ee..ee...eeeeeeeee.....hhhhhhhhhhhh..hhhhhhhhhhhh...ee.hhhhhhhhhhhhhhhhhhhhhhhhee.....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSMDVFMKGLSKA
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372        
search RasMol script viewer Motif-ligand binding stats  PS00001 ..  |  |     |  |      || ||    |||   |    | |        | |               | ||||     || || |||    |  |        |||        | |   |   |  |       || |||     | ||        | |||               |  | | |   |    || ||||| ||  |  |    ||||          |  |||||        ||| |      |    | | || |           | |               | | |  | |  | |   |          | |                  |||||  ||    ||^*** |   || |  
search RasMol script viewer Motif-ligand binding stats  PS00005 ..  |  |     |  |      || ||    |||   |    | |        | |               | ||||     || || |||    |  |        |||        | |   |   |  |       || |||     | ||        | |||               |  | | |   |    || ||||| ||  |  |    ||||          |  |^**|        ^** |      |    | | || |           | |               | | |  | |  | |   |          | |                  ^**||  ||    ||  |  |   || |  
search RasMol script viewer Motif-ligand binding stats  PS00006 ..  |  |     |  |      || ||    |||   |    | |        | |               | ||||     || || |||    |  |        |||        | |   |   ^***       || |||     | ||        | |||               |  | | |   |    || ||||| ||  ^***    ||||          ^*** |||         |  |      |    | | || |           | |               | | ^*** |  | |   |          | |                  ||||^***|    ||  ^***   || |  
search RasMol script viewer Motif-ligand binding stats  PS00007 ..  |  |     |  |      || ||    |||   |    | |        | |               | ||||     |*******^    |  |        |||        | |   |              || |||     | ||        | |||               |  | | |   |    || ||||| ||          ||||             | |||         |  |      |    | | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      || |  
search RasMol script viewer Motif-ligand binding stats  PS00008 ..  |  |     |  |      || ||    |^*****    | |        | |               | ||||     |  || ||     |  |        |||        | |   |              || |||     | ||        | |||               ^***** |   |    || ||||| ||          ||||             | |||         |  |      ^***** | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |^****
search RasMol script viewer Motif-ligand binding stats  PS00009 ..  |  |     |  |      |^***    | |        | |        | |               | ||||     |  || ||     |  |        |||        | |   |              || |||     | ||        | |||               |  |   |   |    || ||||| ||          ||||             | |||         |  |             | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  PS01037 ..  |  |     |  |      |  ||    | |        | |        | |               | ||||     |  || ||     |  |        ******************              || |||     | ||        | |||               |  |   |   |    || ||||| ||          ||||             | |||         |  |             | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |     |  |      *****    | |        | |        | |               | ||||     |  || ||     |  |         ||        | |                  || |||     | ||        | |||               |  |   |   |    || ||||| ||          ||||             | |||         |  |             | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |     |  |      |  |     | |        | |        | |               | ||||     ***** ||     |  |         ||        | |                  || |||     | ||        | |||               |  *****   |    || ||||| ||          ||||             | |||         |  |             | || |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |     |  |      |  |     | |        | |        | |               | ||||        || ||     |  |         ||        ***                  || |||     ***|        | |||               |  |   |   |    || ||||***|          ||||             | |||         |  |             ***| |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  |     |  |      |  |     | |        | |        | |               | ||||        || ||     |  |         **                             || |||     |  |        | |||               |  |   |   |    || |||||  |          ||||             | |||         |  |             |  | |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |     |  |      ****     | |        | |        | |               ****||        ****|     |  |                                        *****|     |  |        ****|               |  |   |   |    |****|||  |          ||||             ****|         ****             |  | |           | |               | |      |  | |   |          | |                  |||||   |    ||  |      ****  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |     |  |               | |        | |        | |                 ||||         |  |     |  |                                        |  | |     |  |          | |               |  |   |   |    |  |||||  |          ||||               | |                          |  | |           ***               | |      |  | |   |          | |                  |||||   |    ||  |            
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |     |  |               ***        ***        ***                 ****         |  |     |  |                                        |  ***     |  |          ***               |  |   |   |    |  ****|  |          ****               ***                          |  | |                             | |      |  | |   |          | |                  ****|   |    ||  |            
search RasMol script viewer Motif-ligand binding stats  niche ..  ****     ****               | |                                                    ****     ****                                        |    |     ****                            ****   |   |    |    | ****                             | |                          **** |                             ***      **** |   |          ***                      |   |    |****            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                              | |                                                                                                         ******                                            |   |    ******                                  | |                             | |                                           |   |                                   |   |    |   |            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                              | |                                                                                                                                                           |   |                                            | |                             | |                                           |   |                                   *****    |   |            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              | |                                                                                                                                                           *****                                            | |                             | |                                           *****                                            *****            
search RasMol script viewer Motif-ligand binding stats  stturn ..                              ***                                                                                                                                                                                                            ***                             ***                                                                                                             

chain C : MALTOSE-BINDING PERIPLASMIC PROTEIN/ALPHA-SYNUCLECHIMERIC PROTEIN;
JMol viewer RasMol script viewer  GOL 397C  ..                                                                                                                                                                                                                                                                                                                                *   *                                                           
JMol viewer RasMol script viewer  GOL 396C  ..                                                                                                                      *                                                                                                                           **                                                                            |   |                                                           
JMol viewer RasMol script viewer  SO4 394C  ..                                                                                                                      |                                                                                                                           ||                                                                    *       |   |                                                           
JMol viewer RasMol script viewer  SO4 393C  ..                                                                                 **                                   |                                                                                                                           ||                                                                    |       |   |                                                           
JMol viewer RasMol script viewer  SO4 392C  ..                **                                                               ||                                   |                                                                                                                           ||                                                                    |       |   |                                                           
JMol viewer RasMol script viewer  SO4 391C  ..                ||                     **                                        ||                                   |                                                                                                                           ||                                                                    |       |   |                                                           
JMol viewer RasMol script viewer  SO4 1C  ..                ||                     ||                                        ||                                   |                              * *                                                        **                                ||                                                                    |       |   |                                                           
JMol viewer RasMol script viewer  MAL 5044C  ..             ** ||                     ||                    ** **               ||                           *       |                              | |****                                                    ||                   *            ||                                                                    |       |   |              *                                            
JMol viewer RasMol script viewer  GOL 1A  ..             || ||                     ||                    || ||               ||                           |       |                              | |||||                                                    ||                   |            ||                                                               **   |       |   |              |                                            
sec str:  ........eeee.....hhhhhhhhhhhhhhhhh..eeee...hhhhhhhhhhh......eeeee..hhhhhhhh........hhhhhh..hhhhhhhhee..ee..eeeeee..eeeee............hhhhhhhhhhh...eee.....hhhhhhhhhhhh..eeeeee..eeeeeeee..hhhhhhhhhhhhhhhhh.......hhhhhhhhhhh..eeeeeehhhhhhhhhhhh..eeee............eeeeeeeee.....hhhhhhhhhhhh..hhhhhhhhhhhh...ee.hhhhhhhhh.hhhhhhhhhhhhhhee.....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhh...
sequence :  ..KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSMDVFMKGLSKAKEG
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..  |  |     |  |       |  ||   |||   |    | |||    | |||               | ||||      | || |||  ||| |||  |    |                |   |  |       || |||     |  |          | |     |  |      |    | |   |       ||||| ||  |  |    ||||          |  |||||        ||| |      |    | |  | |           | |               | | |  | |  | |              | |              |   |||||  |    | |^*** |    |    | |
search RasMol script viewer Motif-ligand binding stats  PS00005 ..  |  |     |  |       |  ||   |||   |    | |||    | |||               | ||||      | || |||  ||| |||  |    |                |   |  |       || |||     |  |          | |     |  |      |    | |   |       ||||| ||  |  |    ||||          |  |^**|        ^** |      |    | |  | |           | |               | | |  | |  | |              | |              |   ^**||  |    | | ||  |    |    | |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..  |  |     |  |       |  ||   |||   |    | |||    | |||               | ||||      | || |||  ||| |||  |    |                |   ^***       || |||     |  |          | |     |  |      |    | |   |       ||||| ||  ^***    ||||          ^*** | |         |  |      |    | |  | |           | |               | | ^*** |  | |              | |              |   ||||^***    | | |^***    |    | |
search RasMol script viewer Motif-ligand binding stats  PS00007 ..  |  |     |  |       |  ||   |||   |    | |||    | |||               | ||||      *******^  ||| |||  |    |                |              || |||     |  |          | |     |  |      |    | |   |       ||||| ||          ||||               | |         |  |      |    | |  | |           | |               | |      |  | |              | |              |   ||||        | | ||       |    | |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..  |  |     |  |       |  ||   |^*****    | |||    | |||               | ||||        || |||  ||| |||  |    |                |              || |||     |  |          | |     |  |      ^***** |   |       ||||| ||          ||||               | |         |  |      ^***** |  | |           | |               | |      |  | |              | |              |   ||||        | | ||       ^***** ^
search RasMol script viewer Motif-ligand binding stats  PS00009 ..  |  |     |  |       ^***|   | |        | |||    | |||               | ||||        || |||  ||| |||  |    |                |              || |||     |  |          | |     |  |             |   |       ||||| ||          ||||               | |         |  |             |  | |           | |               | |      |  | |              | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  PS01037 ..  |  |     |  |           |   | |        | |||    | |||               | ||||        || |||  ||| |||  |    ******************              || |||     |  |          | |     |  |             |   |       ||||| ||          ||||               | |         |  |             |  | |           | |               | |      |  | |              | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |     |  |           |   | |        *****    | |||               | ||||        || |||  ||| |||  |                                    || |||     |  |          | |     |  |             |   |       ||||| ||          ||||               | |         |  |             |  | |           | |               | |      |  | |              | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |     |  |           |   | |        | ||     | |||               | ||||        || |||  ||| |||  |                                    || |||     |  |          | |     |  |             |   |       ||||***|          ||||               | |         |  |             |  | |           | |               | |      |  ***              | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |     |  |           |   | |        ****     ****|               ****||        ****|********|****                                    *****|     |  |          | |     ****             |   |       |||||  |          ||||               | |         ****             **** |           | |               | |      |  |                | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |     |  |           |   | |        | |        | |                 ||||         |  |     |  |                                        |  | |     |  |          | |                      |   |       |||||  |          ||||               | |                          |  | |           ***               | |      |  |                | |              |   ||||        | | ||               
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |     |  |           |   ***        ***        ***                 ****         |  |     |  |                                        |  ***     |  |          ***                      |   |       ****|  |          ****               ***                          |  | |                             | |      |  |                | |              |   ****        | | ||               
search RasMol script viewer Motif-ligand binding stats  niche ..  ****     ****           |   | |                                                    ****     ****                                        |    |     ****                                   |   |           ****                             | |                          **** |                             ***      ****                ***              |   |           | ****               
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                          |   | |                                                                                                         ******                                            |   |                                            | |                             | |                                                                           |   |           |   |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                          ***** |                                                                                                                                                           *****                                            | |                             | |                                                                           *****           *****                
search RasMol script viewer Motif-ligand binding stats  stturn ..                              ***                                                                                                                                                                                                            ***                             ***                                                                                                                

   New search    3q29:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors