triangle PDBeMotif: 3lq3  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.32   2.7.1.82
Classification transferase    | release date: Mon, Feb 8, 2010
Title crystal structure of human choline kinase beta in complex wi phosphorylated hemicholinium-3 and adenosine nucleotide
Authors A.BOCHKAREV, A.M.E, B.S.HONG, C.BOUNTRA, C.H.ARROWSMITH, CONSORTIUM (SGC), F.MACKENZIE, H.W.PARK, J.WEIGELT, STRUCTURAL GENOMIC, W.M.RABEH, W.TEMPEL
Method X-RAY DIFFRACTION (resolution: 1.42Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search ADP ADP binding statistics ADP   search UNX UNX binding statistics UNX   search HC7 HC7 binding statistics HC7   search SO4 SO4 binding statistics SO4   search AMP AMP binding statistics AMP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSHHHHHHSSGLVPRGSVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELRVYPV
SGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLK
TQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPS
PVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIR
HYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSS
S
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CHOLINE/ETHANOLAMINE KINASE
member of: CATH:search3.90.1200.10GENE3D:searchG3DSA_3.10.450.110/searchG3DSA_3.90.1200.10PANTHER:searchPTHR22603/searchPTHR22603_SF28PFAM:searchPF01633SUPERFAMILY:searchSSF56112UniProt:searchQ9Y259
JMol viewer RasMol script viewer  AMP 402A  ..                                *..  *                   *                              *           ****   *                                                                                             *  *     ..AMP ..                                                                                                                                   
JMol viewer RasMol script viewer  ADP 401A  ..                                |..  *                   * *                            *           ****   *                                                                                             ** *     ..ADP ..      *                                                                                                                            
JMol viewer RasMol script viewer  SO4 400A  ..                                |..  |                   | |                            |           ||||   |                                                                                             || |     ..SO4 ..      |                                              *  **                                                                         
JMol viewer RasMol script viewer  UNX 399A  ..                                |..  |                   | |                            |           ||||   |                                                                                             || |     ..UNX ..      |                                              |  ||                                                                         
JMol viewer RasMol script viewer  UNX 398A  ..                                |..  |                   | |                            |           ||||   |                                                                                             || |     ..UNX ..      |                                              |  ||                                                                         
JMol viewer RasMol script viewer  MG 397A  ..                                |..  |                   | |                            |           ||||   |                                                                                             |* |     ..MG ..      *                                              |  ||                                                                         
JMol viewer RasMol script viewer  HC7 396A  ..                                |..  |                   | |                            |           ||||   |                                                                                         * * || |     ..HC7 ..      |  *               *    *      *               |  ||                                     *  *          ** *  *               
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee.....eeeee.............eeeeee......hhhhhhhhhhhhhhhhhh.....eeeee..eeeee...eee.hhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh....eeee....hhh.eeee...... ....eee......eeeehhhhhhhhhhhh.ee.........ee.hhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh.
sequence :  ..SRDAERRAYQWCREYLGGAWRRVQPEELRVYPV..NLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCHNDIQEGNILLLSEP... ..DSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQL
seq num:  ..42        52        62        72 ..80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250  ... ..258       268       278       288       298       308       318       328       338       348       358       368       378        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..||  |   |         || || |  |     .. |    | || | | |||         | |      |   |     || ||||   ||                   |  |             |  |    | |  |   |       |  |  | | | | |  |||||       ||  |       | |  |  |   |  ..PS00004..      ||| |         |    |  || || |       |  |                 |  |  |  |                              |  |  |                | || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..||  |   |         || || |  |     .. |    | || | | |||         | |      |   |     || ||||   ||                   |  |             |  |    | |  |   |       |  |  | | | | |  |^**|       ||  |       | |  |  |   |  ..PS00005..      ||| |         |    |  || || |       |  |                 |  |  |  |                              |  |  |                | || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..||  |   |         || || |  |     .. |    ^*** | ^***|         | |      |   |     || ||||   ||                   |  |             |  |    | |  |   |       |  |  | | | | |  |^***       ||  |       | |  |  |   ^**..PS00006..      ||| |         |    |  || ^***       |  |                 |  |  ^***                              |  ^***                | || 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|*******^         || || |  |     .. |      |  |   | |         | |      |   |     || ||||   ||                   |  |             |  |    | |  |   |       |  |  | | | | |  ||||        ||  |       | |  |  |      ..PS00007..      ||| |         |    |  || ||         |  |                 |  |                                    |  |                   | || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|   |             || || |  |     ..**      |  |   | |         | |      |   |     || ||||   ||                   |  |             |  |    | |  |   |       |  |  | | | | |  ||||        ||  |       | |  |  |      ..PS00008..      ||| |         ^*****  || ||         |  |                 |  |                                    |  |                   | ^**
search RasMol script viewer Motif-ligand binding stats  asxturn ..|   |             || || |  |     ..        |  |   | |         | |      |   |     || ||||   ||                   |  |             |  |    | |  |   |       |  |  | | | ***  ||||        ||  |       | |  |  |      ..asxturn..      ||| |              |  |***|         |  |                 |  |                                    |  |                   |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..|   |             || || |  |     ..        |  |   | |         | |      |   |     || ||||   **                   |  |             |  |    | |  |   |       |  |  | | |      ||||        ||  |       | |  |  |      ..betabulge..      ||| |              |  ||  |         |  |                 |  |                                    |  |                   |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..|   |             ****| |  |     ..        |  |   | |         | |      |   |     |****||                        |  |             |  |    | |  |   |       |  |  | | |      ||||        |****       | |  |  |      ..betaturn..      ||| |              |  ||  |         |  |                 |  |                                    |  |                   **** 
search RasMol script viewer Motif-ligand binding stats  nest ..|   |              |  | |  |     ..        |  |   | |         | |      |   |     |  ****                        |  |             |  |    | |  |   |       |  |  *** |      ****        ||  |       ***  |  |      ..nest..      *** |              |  ||  |         |  |                 |  |                                    |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..|   |              **** ****     ..        ****   ***         ***      |   |     |    |                         ****             ****    ***  |   |       ****  | ***                  |****            ****      ..niche..       ****              ********         ****                 ****                                    ****                        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..|   |                            ..                                    |   |     ******                                                       |   |             | |                    |   |                      ..schellmannloop..                                                                                                                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..*****                            ..                                    |   |                                                                  |   |             | |                    |   |                      ..stmotif..                                                                                                                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                 ..                                    *****                                                                  *****             | |                    *****                      ..ststaple..                                                                                                                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                 ..                                                                                                                             ***                                               ..stturn..                                                                                                                                   

   New search    3lq3:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors