triangle PDBeMotif: 3l6f  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification immune system/peptide binding protein    | release date: Wed, Dec 23, 2009
Title structure of mhc class ii molecule hla-dr1 complexed with phosphopeptide mart-1
Authors R.A.MARIUZZA, Y.LI
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Modified residues:  search SEP SEP binding statistics SEP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
IKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYT
PITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDV
YDCRVEHWGLDEPLLKQWEFDA
Chain B sequence:
MGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYC
RHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLV
MLETVPRSGEVYTCQVEHPSVTSPLTVEWRARS
Chain C sequence:
APPAYEKLSAEQSPP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA
member of: CATH:search2.60.40.10/search3.10.320.10GENE3D:searchG3DSA_2.60.40.10/searchG3DSA_3.10.320.10PANTHER:searchPTHR19944/searchPTHR19944_SF27PFAM:searchPF00993/searchPF07654PROSITE PATTERNS:searchPS00290, PROSITE PROFILES:searchPS50835, SMART:searchSM00407/searchSM00920SUPERFAMILY:searchSSF48726/searchSSF54452UniProt:searchP01903
sec str:  ....eeeeeeeeeee...eeeeeeee..eeeeeee....eeee...hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..........eeeeee.........eeeeeeeeee.....eeeeee..eee....ee...ee.....eeeeeeeee......eeeeeee.......eeeeee.
sequence :  ..EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKQWEF
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           |  | |      |  |     | || ||     ||||||   | |||  |          ||||||               |  |  |                ^***      |||||   |   | |||           |  | | |   |  |          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           |  | |      |  |     | |**^*     ||||||   | |||  |          ||||||               |  |  |                          |||||   |   | |||           |  | | |   |  |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |  | |      |  |     | || |      ||||||   | |||  |          ^**|||               |  |  |                          |||||   |   | |||           |  | | |   |  |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  | |      |  |     | || |      ||||||   | |||  |           | |||               ^***  |                          |||||   |   | |||           ^*** | |   |  |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  | |      |  |     | || |      ||||||   | ^*****           | |||                  |  |                          |||^*****   | |||           |  | | |   |  |          
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..           |  | |      |  |     | || |      ||||||   |  ||              | |||                  |  |                          ||| |       | |||           |  | **^****  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  | |      |  |     | || |      ******   *****              | |||                  |  |                          ||| |       | |||           |  |       |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..           |  | |      |  |     ***| |      ||||||   |  |               | |||                  |  |                          ||| |       | ***           |  |       |  |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           ******      |  |        | |      ||||||   |  |               | |||                  |  |                          ||| |       | |||           |  |       |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |      ****        | |      *****|   ****               ****|                  ****                          ||| |       ****|           |  |       ****          
search RasMol script viewer Motif-ligand binding stats  nest ..              ***                  ***        |  |                        ***                  |  |                          ||| |         ***           |  |       |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..                                              ****                                             ****                          *****                       ****       ****          

chain B : HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DRB1-1 B
member of: CATH:search2.60.40.10/search3.10.320.10GENE3D:searchG3DSA_2.60.40.10/searchG3DSA_3.10.320.10PANTHER:searchPTHR19944/searchPTHR19944_SF42PFAM:searchPF00969/searchPF07654PRODOM:searchPD000328PROSITE PATTERNS:searchPS00290, PROSITE PROFILES:searchPS50835, SMART:searchSM00407/searchSM00921SUPERFAMILY:searchSSF48726/searchSSF54452UniProt:searchP04229
sec str:  .........eeeeeeeeeeee....eeeeeeeeee..eeeeeee.....eee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee.........eeeeeeeeee.....eeeeee..ee....eee...ee.....eeeeeeeee......eeeeeee.......eeeeee.
sequence :  ..MGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |              ^***| |      || | | | | |||||             | ||||      |  ||      | |  ||  |               |  |      |  | | |      |  |  | || | |   |||||           |  | | |   |  |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |                ^** |      || | ^** | |||||             | ^**|      |  ||      | |  ||  |               |  |      |  | | |      |  |  | || | |   |||||           |  | | |   |  |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |                    |      || |   | | |||||             | ^***      |  ||      | |  ||  |               |  |      |  | | |      |  |  | || | |   |||||           |  | | |   |  |          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  | |                    *******^| |   ********^             |  |        |  ||      | |  ||  |               |  |      |  | | |      |  |  | || | |   |||||           |  | | |   |  |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | |                            | |     | ||||              |  |        |  ||      ^*****|  |               |  |      |  | | |      |  |  | ^*****   |||||           |  | | |   |  |          
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..  | |                            | |     | ||||              |  |        |  ||        |   |  |               |  |      |  | | |      |  |  |  | | |   |||||           |  | **^****  |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |                            | |     *****|              |  |        *****        |   |  |               |  |      |  | | |      |  |  |  | | |   |||||           |  |       |  |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | |                            | |     *****|              |  |        |  |         |   |  |               |  |      |  | | |      |  |  |  | | |   |||||           |  |       |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..  ***                            | |     ***| |              |  |        |  |         |   |  |               |  |      |  | | |      |  |  |  | | |   |||||           |  |       |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |                            | |     **** |              |  |        ****         |   ****               |  |      |  | | |      ****  |  | | |   |||||           ****       |  |          
search RasMol script viewer Motif-ligand binding stats  nest ..  ***                            | |        ***              |  |                     |   |  |               |  |      |  | | |            |  | | |   *****           |  |       |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..  ***                            ***                         ****                     |   ****               ****      **** ***            **** | |                   ****       ****          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                      *****                                                     | |                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                ***                                            

chain C : MELANOMA ANTIGEN RECOGNIZED BY T-CELLS 1
member of: PANTHER:searchPTHR15305/searchPTHR15305_SF0PFAM:searchPF14991UniProt:searchQ16655
sec str:  .................
sequence :  ..APPAYEKLSAEQSPP
seq num:  ..1         11   

   New search    3l6f:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors