triangle PDBeMotif: 3kfj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein/peptide    | release date: Tue, Oct 27, 2009
Title crystal structure of the grb2 sh2 domain in complex with a f ac-py-e-n-nh2 tripeptide mimic
Authors J.H.CLEMENTS
Method X-RAY DIFFRACTION (resolution: 2.02Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search YEN YEN binding statistics YEN   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV
DYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR22820PFAM:searchPF00017/searchPF00018PFAMB:searchPB000403PRINTS:searchP67PHOX/searchSH2DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP62993
JMol viewer RasMol script viewer  MG 3A  ..                                                                                                    
JMol viewer RasMol script viewer  CL 2A  ..                                                       **                                           
JMol viewer RasMol script viewer  CL 164A  ..                     **                                ||                                       *   
JMol viewer RasMol script viewer  YEN 1A  ..           *         ||       * * *     *         **** ||       **                              |   
sec str:  ............hhhhhhhhhhh......eeeee.......eeeeeee..eeeeeeeee.....ee....ee.hhhhhhhhh....................
sequence :  ..KPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVP
seq num:  ..56        66        76        86        96        106       116       126       136       146       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |         |  || | |  |        |  |   ^**              | |         |  |    |  || | ||           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |         |  || | |  |        |  |                    | |         ^***    |  || | ||           
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |         |  || | |  |        ****                    | |                 |  || | ||           
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |         |  || | |  |        |  |                    ***                 |  || | ||           
search RasMol script viewer Motif-ligand binding stats  niche ..  ****         |  *********        ****                                        **********           
search RasMol script viewer Motif-ligand binding stats  ststaple ..               *****                                                                 | |            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                     ***            

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR22820PFAM:searchPF00017/searchPF00018PFAMB:searchPB000403PRINTS:searchP67PHOX/searchSH2DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP62993
JMol viewer RasMol script viewer  MG 3A  ..                                                                                                    
JMol viewer RasMol script viewer  CL 2A  ..                                                       **                                           
JMol viewer RasMol script viewer  CL 164A  ..                     **                                ||                                       *   
JMol viewer RasMol script viewer  YEN 1A  ..           *         ||       * * *     *         **** ||       **                              |   
sec str:  ............hhhhhhhhhhh......eeeee.......eeeeeee..eeeeeeeee.....ee....ee.hhhhhhhhh....................
sequence :  ..KPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVP
seq num:  ..56        66        76        86        96        106       116       126       136       146       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |         |  || | |  |        |  |   ^**              | |         |  |    |  || | ||           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |         |  || | |  |        |  |                    | |         ^***    |  || | ||           
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |         |  || | |  |        ****                    | |                 |  || | ||           
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |         |  || | |  |        |  |                    ***                 |  || | ||           
search RasMol script viewer Motif-ligand binding stats  niche ..  ****         |  *********        ****                                        **********           
search RasMol script viewer Motif-ligand binding stats  ststaple ..               *****                                                                 | |            
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                     ***            

   New search    3kfj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors