triangle PDBeMotif: 3j39  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Classification ribosome    | release date: Wed, Feb 27, 2013
Title structure of the d. melanogaster 60s ribosomal proteins
Authors A.M.ANGER, D.N.WILSON, J.-P.ARMACHE, M.HABECK, M.SUBKLEWE, O.BERNINGHAUSEN, R.BECKMANN
Method ELECTRON MICROSCOPY (resolution: 6.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain z sequence:
MASKVSRDTLYEGVNGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFSGTVKLKHIPRPKMKVCILGDQQSHCDEAKA
NNVDFMDAEALKKLNKNKKLVKKLAKSYDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEEVKSTIKFQM
KKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNWQNVRSLHVKSSMGPPQRLY
Chain q sequence:
DRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRG
NVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTG
DKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIFSPEILDIKPEDLRAKFQQGVANLAAVCL
Chain K sequence:
MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQNRQAAISVVPSAASL
IIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTCKEVLGTAQSVGCTVDGKHPHDVIDELNEGSI
EVPAE
Chain O sequence:
MTGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRKRCNVNPARGPFHFRAPSR
IFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRKYCQVGRLSHEVGWHYQDVIKSLER
KRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNKIIKSYGYEV
Chain L sequence:
MGKGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKLRAGRGFTLEEL
KGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIRAGESSLEECKLATQLKGPVLPIKNEQ
PAVVEFREVTKDEKKFKAFATLRKARTDARLVGIRAKRAKEAAESEDAAKGDPKKAKK
Chain V sequence:
MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDMFVATVKKGKPELRKKVMPAV
VIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNASSIA
Chain M sequence:
MPFERFVQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFPYTAPTRIVRKAWTES
DLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLLTIAFNTLKKRTKADGTPRVLKKDRRERLRAEKAKGGK
KAAAKK
Chain a sequence:
MSNIKRKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHKFRPEINLDKLW
SLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPARPVIVKAKYFSKKAEDKIKKAGGVCLLSA
Chain N sequence:
MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIRVRRGGRKRPVPKGCT
YGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYFEVILIDTHHSAIRRDPKINWICKHVHKHRE
LRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRKNREHMHRKR
Chain I sequence:
MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYC
GKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFP
GRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYRPEHGPIAAWEKAQRDVYA
Chain D sequence:
MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDITVQIAYARIEGDRVVCAAYS
HELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYAGCTEVTGEEFNVEPVDDGPGAFRCFLDVGLARTTTGARVF
GAMKGAVDGGLNIPHSVKRFPGYSAETKSFNADVHRAHIFGQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLEDIY
KKAHQAIRNDPTHKVTAKKSSAVTKKRWNAKKLTNEQRKTKIAAHKAAYVAKLQSETEA
Chain Q sequence:
MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQRIARFFKAANQPESTI
VVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALRSPTGKNTLLLQGRRTARTACKHFGKAPGVPH
SHTRPYVRSKGRKFERARGRRSSCGYKK
Chain R sequence:
MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRKNTEARRKGRHCGFGK
RKGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEYIHKKKAEKQRSKMLADQAE
ARRQKVREARKRREERIATKKQELIALHAKEDEIAAKAATAGH
Chain A sequence:
MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAPE
GMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKLPSGAKKVVPS
ANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKVRGVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAA
RRTGRIRGGKGDSKDK
Chain S sequence:
MRAKGLLKEYEVVGRKLPSEKEPQTPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIKQVYETSPVKIKNFGI
WLRYDSRSGTHNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVDSIPAAKTRRVHVKQFHDSKIKFPLVQRVHH
KGNRKLFSFRKPRTYFQ
Chain T sequence:
MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIFNVTQHAVGVIVNKRV
RGKILAKRVNVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQWVSLKRQPEQPKKAHFVKKLEEPIALAPIPYEFIA
Chain P sequence:
MGRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAVIDQKECVPFRRFNGGVGRCAQAKQWKTTQ
GRWPKKSAEFLLQLLRNAEANADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVILTEKEELVSKA
TDDEPAKKKLSKKKLQRQKEKMLRSE
Chain U sequence:
MAPTAKTNKGDTKTAAAKPAEKKAAPAAAAAKGKVEKPKAEAAKPAAAAAKNVKKASEAAKDVKAAAAAAKPAAAKPAAA
KPAAASKDAGKKAPAAAAPKKDAKAAAAPAPAKAAPAKKAASTPAAAPPAKKAAPAKAAAPAAAAPAPAAAAPAVAKPAP
KPKAKAAPAPSKVVKKNVLRGKGQKKKKVSLRFTIDCTNIAEDSIMDVADFEKYIKARLKVNGKVNNLGNNVTFERSKLK
LIVSSDVHFSKAYLKYLTKKYLKKNSLRDWIRVVANEKDSYELRYFRISSNDDEDDDAE
Chain X sequence:
MPPKKPTEKSAKPGDKKPEQKKTAAAPAAGKKEAAPSAAKPAAAAPKKAAAPAAKKAAPAAKKPATAGAAAKKPAAVKTT
AAAKAKSKDAKKKVLAGKKPQSVLAKLSAKARAAAKAKKGVKPVTKPAKGTAKAKAVALLNAKKVQKKIIKGAFGTRARK
IRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDI
KVAKVNVLIRPDGQKKAYVRLARDYDALDIANKIGII
Chain Y sequence:
MKQNPFVSSSRRKNRKRHFQAPSHIRRRLMSAPLSKELRQKYNVRSMPIRRDDEVQVIRGHFKGNQVGKVVQAYRKKFVV
YVEKIQRENANGTNVYVGIHPSKVLIVKLKLDKDRKAILERRGKGRLAALGKDKGKYTEETAAQPMETA
Chain W sequence:
MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGIEEEASKKRTRRTQKFQR
AIVGASLAEILAKRNMKPEVRKAQRDQAIKVAKEQKRAVKAAKKAAAPAPAKKSAPKQKAAKVTQKAAPRVGGKR
Chain Z sequence:
MRKIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPEKPFGHALVAGIDRYPRKVTKKMGKNKLKKKSKVKPFLKSLNYNHL
MPTRYTAHDISFEKLSPKDLKDPVKRKTHRFQTRVKFESVYKEGKNKWFFQKLRF
Chain r sequence:
MATSSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKGFTAVLKKGKYAQRPAKN
TVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALRRASAVLRSQKPAPVKGKKAEFAKGKKPE
Chain h sequence:
MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQKENLRKVFKNKKYKP
LDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVKA
Chain b sequence:
MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVKRYNERIASQKGKPKPVTL
Chain B sequence:
MSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGSKINKKEVVEAVTVLE
TPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKNWYKSKKKAFTKASKKWTDDLGKKSIENDFRKMLRYCKVI
RVIAHSQIRLIKQRQKKAHVMEIQLNGGSIEDKVKWAREHLEKPIQVSNVFGQDEMIDCVGVTKGKGFKGVTSRWHTKKL
PRKTHKGLRKVACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGKVIKNNASTEYDLTDKSITPMGGF
PHYGEVNNDFVMIKGCCIGSKKRIITLRKSLLKHTKRSALEQIKLKFIDTSSKMGHGRFQTPADKLAFMGPLKKDRLKEE
AAATTAAAAAATTTSA
Chain F sequence:
MPAPVVKKPAAKKLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNEYIKAEQREIKLRRLAKK
RNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNLKSVRELIYKR
GFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFTVGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNR
EDQINRLLRKMV
Chain c sequence:
MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIASNTPALRKSEIEYYAMLAKTEVQHYSGTNIE
LGTACGKYFRVCTLSITDPGDSDIIRSLETA
Chain d sequence:
MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVRIDTRLNKHIWSKGIRSTPFR
IRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNLQTENVESSDD
Chain e sequence:
MTIRPAYRPKIVKKRTKHFIRHQSDRYAKLSHKWRKPKGIDNRVRRRFKGQYLMPNIGYGSNKRTRHMLPTGFKKFLVHN
VRELEVLLMQNRVYCGEIAHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE
Chain f sequence:
MADTQAKSTTAPKAAKAQKAPKAVKAPKAEKPAASEAKVSAKKYKRHGRLFAKAVFTGYKRGLRNQHENQAILKIEGARR
KEHGSFYVGKRCVYVYKAETKKCVPQHPERKTRVRAVWGKVTRIHGNTGAVRARFNRNLPGHAMGHRIRIMLYPSRI
Chain g sequence:
MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKLHGITPSRPSERPRMSKRLKTVSRTYGGVL
CHSCLRERIVRAFLIEEQKIVKALKSQREALVKPVKKVVEKKPVKAAAKKPAGKAAGKPGAKVAGKKPAPKGAPKGVVKS
KK
Chain i sequence:
MAVRYELAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRAL
KFLKRRLGTHIRAKRKREELSNILTQLRKAQTHAK
Chain j sequence:
MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGFRE
GTQAKPKKAVASK
Chain k sequence:
MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDKEKADKIKQSLPPGLQVKEVK
Chain l sequence:
MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL
Chain C sequence:
MSLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSELAGHQTSAESWGTGRAVARIP
RVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRKVNVNQRRYALVSAIAASGVPALVQSKGHVIDGVSEFPLVVSDE
VQKVQKTKQAVIFLRRLKIWADIQKVYKSQRFRAGRGTMRDRRRIARRGPLVVYDKDEGLRKAFRNIPGIETINVDKLNL
LKLAPGGHVGRFVIWTESAFARLNDLFGTWKKPSTLKKGYNLPQPKMANTDLSRLLKSEEIRKVLRDPRKRVFRSVRRLN
PLTNVRQLIKLNPYAEVLKRRAALAAEKRTVAKVLAKAKKQNVELAKSHFANVATKAAANRAKLLAARKKKVAAKKPAAK
K
Chain m sequence:
IIEPSLRILAQKYNCDKMICRKCYARLHPRATNCRKKKCGHTNNLRPKKKLK
Chain n sequence:
MRAKWRKKRMRRLKRKRRKMRARSK
Chain p sequence:
MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCKRTVAGGAWVYSTTAAASVR
SAVRRLRETKEQ
Chain o sequence:
MVNVPKQRRTFCKKCKVHKLHKVTQYKKSKERKGAQGRRRYDRKQQGFGGQTKPIFRKKAKTTKKIVLRMECTECKYRKQ
TPLKRCKHFELGGDKKRKGQMIQF
Chain J sequence:
MAAVTKKIKRDPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCTVR
GAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGYNVNHRKRKSGTVGFQH
RLTKEDAMKWFQQKYDGIILNTKK
Chain H sequence:
MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDKRTLKVEKWFGTKKELAAVRTVCSHIENMIK
GVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNSTAQKDELIVEGNDIESVSGSAALIQ
QSTTVKNKDIRKFLDGLYVSEKTTVVKLES
Chain E sequence:
MAPIEKAKKVAKSAKKGKKHPVNSYLKGGILRYSKAQMYKRRALYRLKDKKSPVVEKAKVPIKKSKASYPTKTFVKKRPS
KANFSEHKRNTRRNLTPGTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVP
EHLNDAYFRRLKAKKDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALHSSQYPHR
MRF
Chain G sequence:
MVVKKPRPKKKPVTKKVAPAPLAVKKPVVKKVVNQLFEKRPKNFGIGQNVQPKRDLSRFVRWPKYIRVQRQKAVLQKRLK
VPPPIHQFSQTLDKTTAVKLFKLLEKYRPESPLAKKLRLKKIAEAKAKGKDVEPKKKPSYVSAGTNTVTKLIEQKKAQLV
VIAHDVDPLELVLFLPALCRKMGVPYCIVKGKARLGRLVRRKTCTTLALTTVDNNDKANFGKVLEAVKTNFNERHEEIRR
HWGGGILGSKSLARISKLERAKARELAQKQG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain z : 60S RIBOSOMAL PROTEIN L10A-2
sec str:  ............ee...hhhhhhhhh......eeeeeeee...........eeeee..........eeee...h..hhhhhhhh........hhhhhh..............eeee......hhhhhhhhhhhhhh...........hhhhhhhhh.eeeee.....eeeeeeee...hhhhhhhhhhhhhhhhhhhh......eeeeeeee....eeee.
sequence :  ..MASKVSRDTLYEGVNGLLEASAKKKRGFLETVELQIGLKNYDPQKDKRFSGTVKLKHIPRPKMKVCILGDQQ..HCDEAKANNVDFMDAEALKKLNKNKKLVKKLAKSYDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNWQNVRSLHVKSSMGPPQRLY
seq num:  ..1         11        21        31        41        51        61          ..73        83        93        103       113       123       133       143       153       163       173       183       193       203       213  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || || ||||   ||  || || | | |       |  ||  | | || | |                  ..  |    | |    | | |  |    |  |              |         |   |||| |  | ||           | |   | |||      |  |         ^***   |  |    | |      |  |      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  || || ||||   ||  || || | | |       |  ||  | **^* | |                  ..  |    | |    | | |  |    |  |              |         |   |||| |  | ||           | |   | |||      |  |                |  |    | |      |  |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || || ||||   ||  |^**| | | |       |  ||  |      ^**                  ..  |    | |    | | |  |    |  |              |         |   |||| |  | ||           ^**   | |||      |  |                |  |    | |      |  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  || || ^***   ||  ||  | | | |       |  ||  |                           ..***    | |    | | |  |    |  |              |         |   |||| |  ^***                 | |||      |  |                |  |    | |      |  |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |*******^    ||  ||  | | | |       |  ||  |                           ..       | |    | | |  |    |  |              |         |   |||| |  | |                  | |||      |  |                |  |    | |      |  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  ||  |     ^*****  | | | |       |  ||  |                           ..       | |    | | |  |    |  |              |         ^*****|| |  | |                  | |||      |  |                |  |    | |      |  |      
search RasMol script viewer Motif-ligand binding stats  RIBOSOMAL_L1 ..  |  ||  |      |  |   | | | |       |  ||  |                           ..       | |    | | |  |    |  |              ********************  | |                  | |||      |  |                |  |    | |      |  |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  ||  |      |  |   | | | |       |  ||  |                           ..       | |    | | |  |    |  |                            ||||    | |                  *****      |  |                |  |    | |      |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  ||  |      ****   | | | |       |  ||  |                           ..       | |    | | |  |    |  |                            ||||    | |                  ****|      |  |                |  |    | |      ****      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  ||  |             | | ***       |  ||  |                           ..       | |    | | |  |    |  |                            ||||    | |                    | |      |  |                |  |    | |      |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..  |  ||  |             | | |         |  ||  |                           ..       ***    *** |  |    |  |                            ****    ***                    ***      |  |                |  |    | |      |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..  ********             *****         ********                           ..                  ****    ****                             ***                                    ****                ****    ***      ****      

chain q : 60S ACIDIC RIBOSOMAL PROTEIN P0
sec str:  ....hhhhhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhh....eee.......hhhhhh.....hhhhhhhhhh.....eee.......hhhhhhhh...............eee..........hhhhhhhh...eeee..eeee...eeee......hhhhhhhhhhh.........eeeeee....eehhhhhh.hhhhhhhhhhhhhhhhhhhhh
sequence :  ..DRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIFSPEILDIKPEDLRAKFQQGVANLAAVCL
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | | |          |  |                 |   | |  |  |  |            | |     |  | |       |  |       |  |      |  |        | |              | || |                     |    |    | |              ^***   |  |                      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ^**          |  |                 |   ^**  |  |  |            | |     |  | |       |  |       |  |      |  |        | |              | |^**                     |    |    | |                     |  |                      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |            |  |                 |   | |  |  |  |            | |     |  | |       ^***       |  |      |  |        | |              | |                        |    |    | |                     |  |                      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |            |  |                 |   | |  |  |  |            | |     |  | |                  |  |      |  |        | |              | |                        ^*****    | |                     |  |                      
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |            |  |                 |   | |  |  |  |            | |     **** |                  |  |      |  |        | |              | |                                  | |                     |  |                      
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |            |  |                 |   | |  |  |  |            | |        | |                  |  |      |  |        ***              | |                                  | |                     |  |                      
search RasMol script viewer Motif-ligand binding stats  nest .. ***            |  |                 |   | |  |  |  |            ***        | |                  |  |      |  |                         ***                                  ***                     |  |                      
search RasMol script viewer Motif-ligand binding stats  niche ..                ****                 |   | ****  ****                       ***                  ****      ****                                                                                      ****                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                     *****                                                                                                                                                                                     

chain K : 60S RIBOSOMAL PROTEIN L12
sec str:  ........eeeee........................hhhhhhhhh...........eeeeee..eeeee...hhhhhhhhhh.....................hhhhhhhhhh.......hhhhhhhhhhhh..............hhhhh........
sequence :  ..DPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATSDWKGLKITVCLTIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNIGFEDILAIARVMRPRSMARELKGTCKEVLGTAQSVGCTVDGKHPHDVIDELNEGSIEVP
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             |    |           | ^**      |   |   |  | |                      |  | | |        | |            |  ||||| | |  ^**|  || | || |  |                  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             |    |           | |        |   |   |  | |                      |  | | |        | |            |  ||||| | |  ^***  || | || |  |                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             ^*****           | |        |   |   ^*****                      |  | | |        | |            |  ||||| | |    ||  ^*****| |  |                  
search RasMol script viewer Motif-ligand binding stats  RIBOSOMAL_L11 ..                              | |        |   |      | |                      |  | | |        | |            |  ||||| | |    ****************                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                              | |        |   |      | |                      |  | ***        | |            |  |***| | |     |  || |  | |                     
search RasMol script viewer Motif-ligand binding stats  nest ..                              ***        |   |      ***                      |  |            ***            |  | ***** |     |  || |  ***                     
search RasMol script viewer Motif-ligand binding stats  niche ..                                         |   |                               ****            ***            ****     ***     |  ****                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                         *****                                                                               *****                            

chain O : 60S RIBOSOMAL PROTEIN L13A
sec str:  ..........eeee....hhhhhhhhhhhhhhhh..eeee.....eee.hhhhhhhhhhhh.................hhhhhhhhhhhhh....hhhhhhhhhh.ee............ee.....hhhhhh.....eeehhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh...
sequence :  ..MTGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRKRCNVNPARGPFHFRAPSRIFYKAVRGMIPHKTKRGQAALARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRKYCQVGRLSHEVGWHYQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNKIIKSYGYEV
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    |^***  ||| |              ||||| | ||| |^***        |  |  |     |  |  | |         ||  ||  | | |  |  |    |  || | |     |  | | |||| |           | |                   | |     | || |                  | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    | |    ||| |              ||||| | ||| |            |  |  |     |  |  | |         ||  ||  | | |  |  |    |  || | |     |  | | |||| |           | |                   | |     **^* |                  | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ^**    ||| |              ||||| | ||| |            |  |  |     |  |  | |         ||  ||  ^** |  |  |    |  || | |     |  | | ^**^**           | |                   ^**        ^**                  | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           ||| |              ||||| | ||| |            |  |  |     |  |  | |         ||  ||  |   |  |  |    |  ^*** |     |  | |  ||  |           | |                                                   | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           ||| |              |^***** ||| |            |  |  |     |  |  | |         ||  ||  |   |  |  |    |   | | |     |  | |  ||  |           | |                                                   | |  
search RasMol script viewer Motif-ligand binding stats  RIBOSOMAL_L13 ..           ||| |              |||||   ||| |            |  |  |     |  |  | |         ************************   | | |     |  | |  ||  |           | |                                                   | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           ||| |              |||||   ||| |            |  |  |     |  |  ***          |  ||  |   |  |  |        *** |     |  | |  ||  |           | |                                                   | |  
search RasMol script viewer Motif-ligand binding stats  nest ..           ||| |              *****   *** |            |  |  |     |  |               |  ||  |   |  |  |          | |     |  | |  ||  |           ***                                                   ***  
search RasMol script viewer Motif-ligand binding stats  niche ..           *****                       ****            *******     ****               ********   |  ****          ***     **** ********                                                                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                             *****                                                                                                           

chain L : 60S RIBOSOMAL PROTEIN L13
sec str:  ..........................hhhhhhhhhhhhhhhhhhhh..............................hhhhhh....hhhhhhhhh............hhhhhhhhhhhhh.........................................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..GKGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIRAGESSLEECKLATQLKGPVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVGIRAKRAKEAAESEDAAKG
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |         | |    ||||                   | |           | | |     | | | | ||| |||||||             |^*** |          | |         | |    || ||    | |      | | |   |  |  |  |  |    | |   |                        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |         | |    ||||                   | |           | ^**     | | | | ||| |||||||             | ||  |          | |         | |    || ||    | |      | | |   |  |  |  |  |    ^**   |                        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |         | |    ||||                   | |           | |       | | | ^***| |||||||             | ||  |          | |         | |    ^***|    | |      | | |   |  |  ^***  |      |   |                        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | |         | |    ||||                   | |           | |       | | | | | | ^*****|             | ||  |          | |         | |     |  |    | |      | | |   |  |     |  |      |   |                        
search RasMol script viewer Motif-ligand binding stats  RIBOSOMAL_L13E ..  | |         | |    ||||                   | |           | |       ***************|| |             | ||  |          | |         | |     |  |    | |      | | |   |  |     |  |      |   |                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |         | |    ||||                   | |           | |       | | | | | |  | || |             | |****          | |         | |     |  |    | |      | | |   |  |     |  |      |   |                        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | |         | |    ||||                   | |           | |       *** | | | |  | || |             ***              ***         | |     |  |    | |      | | |   |  |     |  |      |   |                        
search RasMol script viewer Motif-ligand binding stats  nest ..  | |         ***    ****                   | |           | |           ***** |  ******                                          ***     |  |    ***      *** |   |  |     |  |      |   |                        
search RasMol script viewer Motif-ligand binding stats  niche ..  ***                                       ***           ***             |   |                                                          ****               ***   ****     ****      |   |                        
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                          *****                                                                                                      |   |                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                     *****                        

chain V : 60S RIBOSOMAL PROTEIN L23
sec str:  ...............ee...eeee.......eeeeeee...........ee....eeeee....hhhhh..eeeeeeee...........eeee...eeee................hhhhhhhhhhhhhhh....
sequence :  ..GGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDMFVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNASSIA
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117       127       137 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|    |      |    |     |||||       |  |  |  |    |  |    | |  || || |   |    | |   | |||        | | |||||| |    |      |  |   | ^***  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |      |    |     |||||       |  |  |  |    |  |    ^**  || || |   |    | |   | |||        | | |||||| |    |      |  |   |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****      ^*****     |||||       |  |  |  |    |  |         || || |   |    | |   | |||        ^*****|||| ^*****      |  |   |  |    
search RasMol script viewer Motif-ligand binding stats  RIBOSOMAL_L14 ..                       |||||       |  |  |  |    |  |         || || |   *************************** | |||| |           |  |   |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       |||||       |  |  |  |    ****         ****| |        | |   ****|            ****|| |           |  |   |  |    
search RasMol script viewer Motif-ligand binding stats  nest ..                       *****       |  |  |  |    |  |          | || |        | |     ***              ***| |           |  |   |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..                                   ****  ****    ****          ******        ***                         ***           ****   ****    

chain M : 60S RIBOSOMAL PROTEIN L14
sec str:  ............eeee.........eeeeeee....eeeeee....eeeeeee.....eeeee.......hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh..hhhhhhhhhhhhhhhhhhhhh..................hhhhhhhhhh......
sequence :  ..MPFERFVQTGRIAKASAGPLKGRLVAIVDVIDQNRVLVDGPLTGVPRQEYRLNNLHLTKYRIKFPYTAPTRIVRKAWTESDLKAQWKVSPWSVKAQNICKRSSLNDFDRFKLRYAKRQRNKLLTIAFNTLKKRTKADGTPRVLKKDRRERLRAEKAKGG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        | |                    |  |       | |      |  |  | |    |  |         | ||||        | |   ||**^*||| |       |  ||   | || ||**^*  | | |  |             | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        ^**                    |  |       | |      |  |  | |    |  |         | ||||        ^**   ||  ||||| |       |  ||   | || ^**| |  | ^**  |             | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                               |  |       | |      |  |  | |    |  |         ^***||              ||  |^*** |       |  ||   | || || | ^*** | |  |             | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                               |  |       | |      |  |  | |    |  |           ||||              ||  | ||  |       |  ||   | || || |    | | |  |             ^*
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                               |  |       | |      |  |  | |    |  |           ||||              ||  | ||  |       |  ||   | || || |    | | |  |             ^*
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                               |  |       | |      |  |  | |    |  |           ||||              ||  | ||  |       *****   | || || |    | | |  |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                               |  |       | |      |  |  | |    |  |           ||||              ||  | |****       ****    | || || |    | | ****               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                               |  |       | |      |  |  | |    |  |           ||||              ||  ***                   | || || |    | |                    
search RasMol script viewer Motif-ligand binding stats  nest ..                               |  |       ***      |  |  | |    |  |           ****              ||  |                     | || || |    ***                    
search RasMol script viewer Motif-ligand binding stats  niche ..                               ****                ****  ***    ****                             |****                     *********                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                         | |                                     *****                                                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                         ***                                                                                                   

chain a : 60S RIBOSOMAL PROTEIN L27A
sec str:  ...........................................hhhhhh.........................eee........hhhhhh...........eee.......eee..........eeee.eehhhhhhhhhhh..eeee..
sequence :  ..MSNIKRKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRRQHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPARPVIVKAKYFSKKAEDKIKKAGGVCLLSA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | **^*|| |   | |           |  | |             |  |                        |||| |       |  | | |      | ||| |       | |         | |       |||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  | ^** |   | |           |  | |             |  |                        |||| |       |  | ^**      | ||| |       | |         ^**       |||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |  |  |   | |           ^*****             |  |                        |||| |       |  |          | ||| |       | |                   |||      
search RasMol script viewer Motif-ligand binding stats  RIBOSOMAL_L15 ..   |  |  |  |   | |              | |             |  |                        |||| |       |  |          | ||| ********************************|      
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |  |  |   | |              | |             ****                        |||| |       |  |          ****|         | |                   | |      
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |  |  |   ***              | |                                         **** |       |  |            ***         | |                   ***      
search RasMol script viewer Motif-ligand binding stats  niche ..   ****  ****                    ***                                           ****       ****                        ***                            

chain N : 60S RIBOSOMAL PROTEIN L15
sec str:  ...hhhhhhhhhhh..hhhhhhhhhhhhhhh......eee....hhhhhh.........eeeeeee.................hhhhh.........hhhhhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeee..hhhhhhhhhhhhhhhhhhh.......hhhhhhhhh...hhhhh.......hhhhhhhh........
sequence :  ..GAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIRVRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYFEVILIDTHHSAIRRDPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRKNREHMHRKR
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           **^*    |                 | | |  |   ||||| |            |  || |  |    | |  ||  |       |  |  |  ||  |            | |       |  |     |  | |  || ||| | ||||  | | |||   | | |   || | |  |  |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |  |    |                 ^** |  |   ||||| |            |  || |  |    | |  ||  |       |  |  |  ||  |            ^**       |  |     |  | |  || ||| | ||||  | ^**||   | | |   |^** |  |  |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |    |                     ^***   ||||| |            |  || |  |    | |  ||  |       ^***  |  ||  |                      |  |     |  | |  || ||| | ||||  | | |||   | | |   |    |  |  |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..           ********^                        |   ||||| |            |  || |  |    | |  ||  |             |  ||  |                      |  |     |  | |  || ||| | ||||  | | |||   | | |   |    |  |  |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |                             |   ||||| |            |  || |  ^***** |  ||  |             |  ||  |                      |  |     |  | |  || ||| | |^***** | |^***** | |   ^*****  |  |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..           |  |                             |   ||||| |            ^***| |         |  ||  |             ^***|  |                      |  |     |  | |  || ||| | ||||    | | |     | |           |  |       
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..           |  |                             |   ||||| |            |   | |         |  ||  |                 |  |                      |  |     |  | |  || ||| | |******** | |     | |           |  |       
search RasMol script viewer Motif-ligand binding stats  RIBOSOMAL_L15E ..           |  |                             ************************   | |         |  ||  |                 |  |                      |  |     |  | |  || ||| | ||||      | |     | |           |  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |                                 ||||| |                | |         |  ||  |                 |  |                      |  |     **** |  ****|| | ||||      | |     | |           |  |       
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |                                 ****| |                | |         |  ||  |                 |  |                      |  |          |  ||  |*** ****      ***     | |           |  |       
search RasMol script viewer Motif-ligand binding stats  niche ..           ****                                     ***                ***         ********                 ****                      ****          ********     ***              ***           ****       

   New search    3j39:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML