triangle PDBeMotif: 3j22  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification virus    | release date: Mon, Aug 13, 2012
Title the enterovirus 71 a-particle
Authors K.L.SHINGLER
Method ELECTRON MICROSCOPY (resolution: 6.30Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
HSTAETTLDSFFSRAGLVGEIDLPLKGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQ
YMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTFGEHKQEKDLEYGAMPNNMMGT
FSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL
Chain B sequence:
VAQLTIGNSTITTQEAANIIVGYGEWPSYCSDSDATAVDKPTRPDVSVNRFYTLDTKLWEKSSKGWYWKFPDVLTETGVF
GQNAQFHYLYRSGFCIHVQCNASKFHQGALLVAVLPEYVIGTVAGGTGTEDTHPPYKQTQPGADGFELQHPYVLDAGIPI
SQLTVCPHQWINLRTNNCATIIVPYINALPFDSALNHCNFGLLVVPISPLDYDQGATPVIPITITLAPMCSEFAGLR
Chain C sequence:
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKG
ELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFG
LQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CAPSID PROTEIN VP1
member of: GENE3D:searchG3DSA_2.60.120.20PFAM:searchPF00073PRODOM:searchPD001306SUPERFAMILY:searchSSF88633UniProt:searchB2ZUN0
sec str:  ........hhhhhhh..eeeeeeee..........eeeee.hhhhhhhhhhhhh.eeeeeeeeeeeeeee.........eeeeeee...........hhhhh.....eeeee.....eeeee........ee........................eeeeee.........eeeeeeeeeeeeeeeee..................................
sequence :  ..HSTAETTLDSFFSRAGLVGEIDLPLKGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPT..KDLEYGAMPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL
seq num:  ..73        83        93        103       113       123       133       143       153       163       173       183       193       203     ..218       228       238       248       258       268       278       288       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |||| ||       ||       | |  | |     ||| |   |  |  | |            | |||           |  |       |||| |  |     |  |          | |           |.. |  ||  ||||    ^**  |^**|||                     | |   |  | |    ^**  |    |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***^***|       ||       | |  | |     ||| |   |  |  | |            | |||           |  |       |||| |  |     |  |          | |           ^.. |  ||  ||||         | | |||                     | |   |  | |         |    |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   || |  |       ||       | |  | |     ||| |   ********^            | |||           |  |       |||| |  |     |  |          | |            ..****^|  ||||         | | |||                     | |   |  | |         |    |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   || |  |       ||       | |  | |     ||| |      |  |              | |||           |  |       |||| |  |     |  |          | |            .. |  |^*****|         ^*****|                     | |   |  | |         ^*****    
search RasMol script viewer Motif-ligand binding stats  asxturn ..   || |  |       ||       | |  | |     *** |      |  |              | |||           |  |       |||| |  |     |  |          | |            .. |  |   ||||         | | | |                     | |   |  | |                   
search RasMol script viewer Motif-ligand binding stats  betabulge ..   || |  |       **       | |  | |      |  |      |  |              | |||           |  |       |||| |  |     |  |          | |            .. |  |   ||||         | | | |                     | |   |  | |                   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..   || |  |                | |  | |      |  |      |  |              *****           |  |       |||| |  |     |  |          | |            .. |  |   ||||         | | | |                     | |   |  | |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..   || |  |                | |  | |      |  |      ****              ****|           |  |       **** |  |     |  |          | |            .. |  |   ||||         | | | |                     | |   |  | |                   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   || |  |                | |  | |      |  |      |  |                | |           |  |        ||  |  |     |  |          | |            .. |  |   ***|         | | | |                     | |   |  | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..   || |  |                | |  ***      |  |      |  |                ***           |  |        ||  |  |     |  |          | |            .. |  |    | |         | | | |                     | |   |  | |                   
search RasMol script viewer Motif-ligand binding stats  niche ..   ****  |                ***           ****      ****                              ****        |*******     ****          ***            .. ****    ***         *** | |                     ***   ******                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..    ******                                                                                      *****                      | |            ..                         | |                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                           ***            ..                         ***                                                    

chain B : CAPSID PROTEIN VP0
member of: GENE3D:searchG3DSA_2.60.120.20PFAM:searchPF00073SUPERFAMILY:searchSSF88633UniProt:searchB2ZUN0
sec str:  ...eeee....eeee......ee.hhh..........................eeeeeeee......eeeee................eeeeeeeeeeeeee......eeeeeeeeee..................hhhhhhhhhhh....hhhhh....hhhhhhhh.eeeee......eeeee................eeeeeeeeeeee........eeeeeeeeeeeeeeeee.
sequence :  ..VAQLTIGNSTITTQEAANIIVGYGEWPSYCSDSDATAVDKPTRPDVSVNRFYTLDTKLWEKSSKGWYWKFPDVLTETGVFGQNAQFHYLYRSGFCIHVQCNASKFHQGALLVAVLPEYVIGTVAGGTGTEDTHPPYKQTQPGADGFELQHPYVLDAGIPISQLTVCPHQWINLRTNNCATIIVPYINALPFDSALNHCNFGLLVVPISPLDYDQGATPVIPITITLAPMCSEFAGLR
seq num:  ..13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      |^***|  |     |  | | |  |  | |  |  |  |              | |||        ||  |      |  |             ^***||              | | ||||||  |                   | | |  | || ||     ||| | |               |  |          |  |                          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |  |  |     |  | | |  |  | |  |  |  |              | ^**        ||  |      |  |               | ||              | | ||||||  |                   | | |  | || ||     ||| | |               |  |          |  |                          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |  ^***     |  | | |  ^*** ^***  ^***              |  |         ||  |      |  |               | ||              | | ||^***  |                   | | |  | || ||     ||| | |               |  |          ^***                          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | |           |  | | |                               |  |         ||  |      |  |               | ||              ^*****|^*****                   | | ^*****| ||     ||| | |               |  |                                        
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | |           |  | | |                               |  |         ||  |      |  |               | ||                | | ||||                      | |    | || ||     *** | |               |  |                                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |           **** | |                               |  |         ||  |      |  |               | ||                | | ||||                      | |    *******      |  | |               |  |                                        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | |                ***                               |  |         ||  |      |  |               | ||                | | ||||                      | |       |  |      |  | |               |  |                                        
search RasMol script viewer Motif-ligand binding stats  nest ..      | |                                                  |  |         ||  |      |  |               | ||                *** ****                      ***       |  |      |  | |               |  |                                        
search RasMol script viewer Motif-ligand binding stats  niche ..      ***                                                  ****         |****      ****               ****                                                        ****      ******               ****                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                        *****                         | |                                                                                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                      ***                                                                                                                                    

chain C : CAPSID PROTEIN VP3
member of: GENE3D:searchG3DSA_2.60.120.20PFAM:searchPF00073SUPERFAMILY:searchSSF88633UniProt:searchB2ZUN0
sec str:  .......................ee...............ee..hhhhhh..ee........hhhhhhhh.eeeee.......eeeeeee.....hhhhhhhhhhhhh.eeeeeeeeeeeeee.........eeeeee........hhhhhh...eeee......eeeeeeeeeee.eee......eee....eeeeeee............eeeeeeeeee....eeeee..........
sequence :  ..GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | || | || ||      |  |             | | |  | |  | |||| ^***  |  |   | |||  |              |  |  |||| ||              || ||| |                  |  |     | ||   |                       ||||            | ||   |        | ^***|     | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | || | || ||      |  |             | | |  | |  | |||| |  |  |  |   | |||  |              |  |  |||| ||              || ||^**                  |  |     | ||   |                       ||||            | ||   |        |  |^**     | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | || | |^***      |  |             | | |  | ^*** |||| |  ^***  |   | |||  |              |  |  |||| ||              || |||                    |  |     | ||   |                       ||||            | ||   |        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | || | |  |       |  |             | | |  |      |||| |  |  |  |   | |||  |              |  |  ^*****|              ^*****                    |  |     | ^*****                       ||||            | ^*****        |  |        | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | || | |  |       |  |             *** |  |      |||| |  |  |  |   | |||  |              |  |   ||| ||               | ||                     |  |     |  |                           ||||            |  |            |  |        | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..      **** | |  |       |  |                 |  |      |||| **********   | ||****              |  |   |****|               | ||                     |  |     ****                           ||||            |  |            |  |        | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | || | |  |       |  |                 |  |      ***| |     |  |   | |||  |              |  |   | |  |               | ||                     |  |                                    |***            |  |            |  |        | |    
search RasMol script viewer Motif-ligand binding stats  nest ..      | || | |  |       |  |                 |  |       | | |     |  |   | |||  |              |  |   | |  |               | ||                     |  |                                    ***             |  |            |  |        | |    
search RasMol script viewer Motif-ligand binding stats  niche ..      ****** ****       ****                 ****       *****     ****   ********              ****   | ****               ****                     ****                                    ***             ****            ****        ***    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                         | |                      *****                    | |                                                                                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                         ***                                               ***                                                                                                                 

   New search    3j22:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML