triangle PDBeMotif: 3i5s  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Mon, Jul 6, 2009
Title crystal structure of pi3k sh3
Authors D.WILLBOLD, J.GRANZIN, R.BATRA-SAFFERLING, S.HOFFMANN, S.MODDER
Method X-RAY DIFFRACTION (resolution: 3.00Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRK
KIS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY SUBUNITALPHA;
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10155/searchPTHR10155_SF3PFAM:searchPF07653PROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchP27986
JMol viewer RasMol script viewer  SO4 84A  ..                                             *                               
sec str:  ....eeeee..................eeeehhhhhhh.....hhhhhhhhh.eeeeee.....eeeee...eeeeee.
sequence :  ..EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRK
seq num:  ..4         14        24        34        44        54        64        74     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              |  |   |  |      | || |||  ||| ||  |      ^*** || |  || || |  |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              |  |   |  |      | || |||  ||| ||  |      | || || |  || || |  *
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |  |   |  |      | || |||  ||| ||  |      | ^***| |  |^*** |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |   |  |      ^*****||  ||| ||  |      | || || |  |  |  |  |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..              |  |   |  |        || |||  ||| ||  |      | || || |  |  |  ^***
search RasMol script viewer Motif-ligand binding stats  RGD ..              |  |   |  |        || |||  ||| ||  |      | || |***  |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..              |  |   |  |        || |||  ||| ||  |      ***| |     |  |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..              |  |   |  |        || |||  ||| ||  |      ******     |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |  |   ****        |****|  |********         | |     |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |   |  |        |  ***  ***               ***     |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..              ****   ****        |    |                            ****      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                 ******                                      

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY SUBUNITALPHA;
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10155/searchPTHR10155_SF3PFAM:searchPF07653PROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchP27986
sec str:  ...eeeeee..................eeeeehhhhhh.....hhhhhhhhh.eeeeee.....eeeee...eeeeee.
sequence :  ..EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRK
seq num:  ..4         14        24        34        44        54        64        74     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              |  |   |  |      | || |||  ||| ||  |      ^*** || |  || || |  |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              |  |   |  |      | || |||  ||| ||  |      | || || |  || || |  *
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |  |   |  |      | || |||  ||| ||  |      | ^***| |  |^*** |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |   |  |      ^*****||  ||| ||  |      | || || |  |  |  |  |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..              |  |   |  |        || |||  ||| ||  |      | || || |  |  |  ^***
search RasMol script viewer Motif-ligand binding stats  RGD ..              |  |   |  |        || |||  ||| ||  |      | || |***  |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..              |  |   |  |        || |||  ||| ||  |      ***| |     |  |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..              |  |   |  |        || |||  ||| ||  |      ******     |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |  |   ****        |****|  |********         | |     |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |   |  |        |  ***  ***               ***     |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..              ****   ****        |    |                            ****      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                 ******                                      

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY SUBUNITALPHA;
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10155/searchPTHR10155_SF3PFAM:searchPF07653PROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchP27986
sec str:  ...eeeeee..................eeeeehhhhhh.....hhhhhhhhh.eeeeee.....eeeee...eeeeee.
sequence :  ..EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRK
seq num:  ..4         14        24        34        44        54        64        74     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              |  |   |  |      | || |||  ||| ||  |      ^*** || |  || || |  |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              |  |   |  |      | || |||  ||| ||  |      | || || |  || || |  *
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |  |   |  |      | || |||  ||| ||  |      | ^***| |  |^*** |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |   |  |      ^*****||  ||| ||  |      | || || |  |  |  |  |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..              |  |   |  |        || |||  ||| ||  |      | || || |  |  |  ^***
search RasMol script viewer Motif-ligand binding stats  RGD ..              |  |   |  |        || |||  ||| ||  |      | || |***  |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..              |  |   |  |        || |||  ||| ||  |      ***| |     |  |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..              |  |   |  |        || |||  ||| ||  |      ******     |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |  |   ****        *****|  |********         | |     |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |   |  |        |  ***  ***               ***     |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..              ****   ****        |    |                            ****      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                 ******                                      

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY SUBUNITALPHA;
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR10155/searchPTHR10155_SF3PFAM:searchPF07653PROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchP27986
sec str:  ...eeeeee..................eeeeehhhhhh.....hhhhhhhhh.eeeeee.....eeeee...eeeeee.
sequence :  ..EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRK
seq num:  ..4         14        24        34        44        54        64        74     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..              |  |   |  |      | || |||  ||| ||  |      ^*** || |  || || |  |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..              |  |   |  |      | || |||  ||| ||  |      | || || |  || || |  *
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |  |   |  |      | || |||  ||| ||  |      | ^***| |  |^*** |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |   |  |      ^*****||  ||| ||  |      | || || |  |  |  |  |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..              |  |   |  |        || |||  ||| ||  |      | || || |  |  |  ^***
search RasMol script viewer Motif-ligand binding stats  RGD ..              |  |   |  |        || |||  ||| ||  |      | || |***  |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..              |  |   |  |        || |||  ||| ||  |      ***| |     |  |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..              |  |   |  |        || |||  ||| ||  |      ******     |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |  |   ****        |****|  |********         | |     |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |   |  |        |  ***  ***               ***     |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..              ****   ****        |    |                            ****      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                 ******                                      

   New search    3i5s:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors