triangle PDBeMotif: 3gbq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification complex (signal transduction/peptide)    | release date: Mon, Dec 23, 1996
Title solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
Authors C.A.MEYERS, C.MAPELLI, L.MUELLER, M.S.FRIEDRICHS, M.WITTEKIND, V.GOLDFARB, V.LEE
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search ACE ACE binding statistics ACE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPEFIVTD
Chain B sequence:
VPPPVPPRRRX
Residue colours:  hydrophilic   hydrophobic   intermediate 
    View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GRB2
member of: GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR22820PFAM:searchPF00017/searchPF00018PRINTS:searchP67PHOX/searchSH2DOMAIN/searchSH3DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchQ60631
sec str:  ...eeee..................eee.........eeeeee..eeeeeehhheeee.
sequence :  ..MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKP
seq num:  ..1         11        21        31        41        51     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   |       || || | ||||                 |  |     |  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |       || || ^**|||                 |  |     |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |       ^***|   ||||                 |  |     |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****        |  |   ||||                 |  |     |  |    
search RasMol script viewer Motif-ligand binding stats  RGD ..            |  |   |***                 |  |     |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  |   ****                 ****     |  |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            |  |   ***|                          |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..            ****   ****                          ****    

chain B : SOS-1
member of: UniProt:searchQ62245
JMol viewer RasMol script viewer  ACE 0B  ..**         
sec str:  ....eeeeee...
sequence :  ..VPPPVPPRRRX
seq num:  ..1          

   New search    3gbq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML