triangle PDBeMotif: 3csm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   5.4.99.5
Classification complex (isomerase/peptide)    | release date: Thu, Jul 10, 1997
Title structure of yeast chorismate mutase with bound trp and an endooxabicyclic inhibitor
Authors G.BRAUS, G.SCHNAPPAUF, N.STRAETER, W.N.LIPSCOMB
Method X-RAY DIFFRACTION (resolution: 3.00Å)
PDBe Citation   
Small molecules:    search TRP TRP binding statistics TRP   search TSA TSA binding statistics TSA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MDFTKPETVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFLDWALSNLEIAHSRIRRFESP
DETPFFPDKIQKSFLPSINYPQILAPYAPEVNYNDKIKKVYIEKIIPLISKRDGDDKNNFGSVATRDIECLQSLSRRIHF
GKFVAEAKFQSDIPLYTKLIKSKDVEGIMKNITNSAVEEKILERLTKKAEVYGVDPTERRIERRITPEYLVKIYKEIVIP
ITKEVEVEYLLRRLEE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CHORISMATE MUTASE
member of: CATH:search1.10.590.10GENE3D:searchG3DSA_1.10.590.10PANTHER:searchPTHR21145PFAM:searchPF01817PFAMB:searchPB002031PIRSF:searchPIRSF017318PROSITE PROFILES:searchPS51169, SUPERFAMILY:searchSSF48600TIGRFAMS:searchTIGR01802UniProt:searchP32178
JMol viewer RasMol script viewer  TSA 400A  ..               *                                                                                                                                            *      *   *                       ***   *  *                ..TSA ..                 *  **  *          
JMol viewer RasMol script viewer  TRP 300A  ..               |                                                                                                                         *****  *           |      |   |                       |||   |  |                ..TRP ..                 |  ||  |          
sec str:  .......hhhh..hhhhhhhhhhhhhhhhhhhhhhhh....hhhh....hhh........hhhhhhhhhhhhhhhh.hhh........hhh..................hhh...hhhhhhhhhh.hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh..hhhhhhhhhhhhhhhhhh........ .......hhhhhhhhhh.hhhhhhhhhhhhhhhh...
sequence :  ..MDFTKPETVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFLDWALSNLEIAHSRIRRFESPDETPFFPDKIQKSFLPSINYPQILAPYAPEVNYNDKIKKVYIEKIIPLISKRDGDDKNNFGSVATRDIECLQSLSRRIHFGKFVAEAKFQSDIPLYTKLIKSKDVEGIMKNITNSAVEEKILERLTKKAEVYGVDPT... ..ERRITPEYLVKIYKEIVIPITKEVEVEYLLRRLEE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211    ... ..222       232       242       252  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||| ||       |   ||  ||    | || ||     ||| |||  ||||| |||| |  |^***|  |       | |  | ||| |..PS00001.. | ||           |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||| ||       |   ||  ||    | || ||     ||| |||  ||||| |||| |  | || |  |       | |  | ||| |..PS00004.. **^*           |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||^**|       |   ||  ||    ^**| ||     ||| |||  ||||| |||| |  | || |  |       ^**  | ||| ^..PS00005.. | |            |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | ^***|  |   ||   |  |         |  |    ^***  |  | |  |  ^***|  ^***||    ||| ^***    |  |  | |           || ||| | |  |     |||||^***       |   ||  ||      || ||     ||| |||  ||||| |||| |  | || ^***            | ||| |..PS00006.. | |            |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  ||  ||    ||| |  |    |  |  | |           || ||| | |  |     ||||||          |   ||  ||      || ||     |********^|||| |||| |  | ||                 | ||| |..PS00007.. | |            |   |******^|| |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  ||  ||    ||| |  |    |  |  | |           || ||| | |  |     ||||||          ^*****  ||      || ||     | | |||   |||| |||| ^*****|                 | ^****..PS00008.. | |            |   || |||  || |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  |*****    ||| |  |    |  |  | |           || ||| | |  |     *****|          |   |*****      || ||     | | |||   |||| ||||    |  |                 |  || |..alphabetamotif.. | |            |   ********** |   
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |   |  *****|   |  |         |  |    |  |  |  | |  |  |  ||  ||  |     ||| |  |    |  |  | |           || ||| | |  |     |||| |          |   ||  |       || ||     | | |||   |||| ||||    |  |                 |  || |..asxmotif.. | |            |   || |||  |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn .. ***   |  |    |   |  |         |  |    |  |  |  | |  |  |  ||  ||  |     ||| |  |    |  |  | |           || ||*** |  |     |||| |          |   ||  |       || ||     | | |||   |||| ||||    |  |                 |  |***..asxturn.. | |            |   || |||  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |  |    |   ****         |  |    |  |  **** ****  |  ||  |****     ||| |  |    |  |  | |           *****    ****     **** |          |   |****       *****     | ****|   |||****||    |  |                 |  |   ..betaturn.. | |            |   ************   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |  |    |                |  |    |  |       |  |  |  ||  |         ||| |  |    |  |  | |            |  |              ||  |          |   |                     |   | |   |||  |***    |  |                 |  |   ..gammaturn.. | |            |   |              
search RasMol script viewer Motif-ligand binding stats  nest ..       |  |    |                |  |    |  |       |  |  |  ||  |         *** |  |    |  |  | |            |  |              ||  |          |   |                     |   | |   |||  ***     |  |                 |  |   ..nest.. ***            |   |              
search RasMol script viewer Motif-ligand binding stats  niche ..       ****    |                ****    ****       ****  |  ||  |          *******    ****  | |            ****              |****          |   |                     |   | |   |||  | |     ****                 ****   ..niche..                |   |              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..               |                |                        |  ||  |                           | |                              |   |          |   |                     |   | |   ||******                                 ..schellmannloop..                |   |              
search RasMol script viewer Motif-ligand binding stats  stmotif ..               |                |                        *****  |                           | |                              |   |          |   |                     |   | |   ||   |                                   ..stmotif..                |   |              
search RasMol script viewer Motif-ligand binding stats  ststaple ..               |                |                           *****                           | |                              *****          *****                     ***** **********                                   ..ststaple..                *****              
search RasMol script viewer Motif-ligand binding stats  stturn ..               |                |                                                           ***                                                                                                                          ..stturn..                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..               *                *                                                                                                                                                                                        ..REP00000..                                   

chain B : CHORISMATE MUTASE
member of: CATH:search1.10.590.10GENE3D:searchG3DSA_1.10.590.10PANTHER:searchPTHR21145PFAM:searchPF01817PFAMB:searchPB002031PIRSF:searchPIRSF017318PROSITE PROFILES:searchPS51169, SUPERFAMILY:searchSSF48600TIGRFAMS:searchTIGR01802UniProt:searchP32178
JMol viewer RasMol script viewer  TSA 400B  ..               *                                                                                                                                            *      *   *                       ***   *  *                ..TSA ..                 *  **  *          
JMol viewer RasMol script viewer  TRP 300B  ..               |                                                                                                                         *****  *           |      |   |                       |||   |  |                ..TRP ..                 |  ||  |          
sec str:  .......hhhh..hhhhhhhhhhhhhhhhhhhhhhhh....hhhh....hhh........hhhhhhhhhhhhhhhh.hhh........hhh..................hhh...hhhhhhhhhh.hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh..hhhhhhhhhhhhhhhhhh........ .......hhhhhhhhhh.hhhhhhhhhhhhhhhh...
sequence :  ..MDFTKPETVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFLDWALSNLEIAHSRIRRFESPDETPFFPDKIQKSFLPSINYPQILAPYAPEVNYNDKIKKVYIEKIIPLISKRDGDDKNNFGSVATRDIECLQSLSRRIHFGKFVAEAKFQSDIPLYTKLIKSKDVEGIMKNITNSAVEEKILERLTKKAEVYGVDPT... ..ERRITPEYLVKIYKEIVIPITKEVEVEYLLRRLEE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211    ... ..222       232       242       252  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||| ||       |   ||  ||    | || ||     ||| |||  ||||| |||| |  |^***|  |       | |  | ||| |..PS00001.. | ||           |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||| ||       |   ||  ||    | || ||     ||| |||  ||||| |||| |  | || |  |       | |  | ||| |..PS00004.. **^*           |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||^**|       |   ||  ||    ^**| ||     ||| |||  ||||| |||| |  | || |  |       ^**  | ||| ^..PS00005.. | |            |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | ^***|  |   ||   |  |         |  |    ^***  |  | |  |  ^***|  ^***||    ||| ^***    |  |  | |           || ||| | |  |     |||||^***       |   ||  ||      || ||     ||| |||  ||||| |||| |  | || ^***            | ||| |..PS00006.. | |            |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  ||  ||    ||| |  |    |  |  | |           || ||| | |  |     ||||||          |   ||  ||      || ||     |********^|||| |||| |  | ||                 | ||| |..PS00007.. | |            |   |******^|| |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  ||  ||    ||| |  |    |  |  | |           || ||| | |  |     ||||||          ^*****  ||      || ||     | | |||   |||| |||| ^*****|                 | ^****..PS00008.. | |            |   || |||  || |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  |*****    ||| |  |    |  |  | |           || ||| | |  |     *****|          |   |*****      || ||     | | |||   |||| ||||    |  |                 |  || |..alphabetamotif.. | |            |   ********** |   
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |   |  *****|   |  |         |  |    |  |  |  | |  |  |  ||  ||  |     ||| |  |    |  |  | |           || ||| | |  |     |||| |          |   ||  |       || ||     | | |||   |||| ||||    |  |                 |  || |..asxmotif.. | |            |   || |||  |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn .. ***   |  |    |   |  |         |  |    |  |  |  | |  |  |  ||  ||  |     ||| |  |    |  |  | |           || ||*** |  |     |||| |          |   ||  |       || ||     | | |||   |||| ||||    |  |                 |  |***..asxturn.. | |            |   || |||  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |  |    |   ****         |  |    |  |  **** ****  |  ||  |****     ||| |  |    |  |  | |           *****    ****     **** |          |   |****       *****     | ****|   |||****||    |  |                 |  |   ..betaturn.. | |            |   ************   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |  |    |                |  |    |  |       |  |  |  ||  |         ||| |  |    |  |  | |            |  |              ||  |          |   |                     |   | |   |||  |***    |  |                 |  |   ..gammaturn.. | |            |   |              
search RasMol script viewer Motif-ligand binding stats  nest ..       |  |    |                |  |    |  |       |  |  |  ||  |         *** |  |    |  |  | |            |  |              ||  |          |   |                     |   | |   |||  ***     |  |                 |  |   ..nest.. ***            |   |              
search RasMol script viewer Motif-ligand binding stats  niche ..       ****    |                ****    ****       ****  |  ||  |          *******    ****  | |            ****              |****          |   |                     |   | |   |||  | |     ****                 ****   ..niche..                |   |              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..               |                |                        |  ||  |                           | |                              |   |          |   |                     |   | |   ||******                                 ..schellmannloop..                |   |              
search RasMol script viewer Motif-ligand binding stats  stmotif ..               |                |                        *****  |                           | |                              |   |          |   |                     |   | |   ||   |                                   ..stmotif..                |   |              
search RasMol script viewer Motif-ligand binding stats  ststaple ..               |                |                           *****                           | |                              *****          *****                     ***** **********                                   ..ststaple..                *****              
search RasMol script viewer Motif-ligand binding stats  stturn ..               |                |                                                           ***                                                                                                                          ..stturn..                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..               *                *                                                                                                                                                                                        ..REP00000..                                   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CHORISMATE MUTASE
member of: CATH:search1.10.590.10GENE3D:searchG3DSA_1.10.590.10PANTHER:searchPTHR21145PFAM:searchPF01817PFAMB:searchPB002031PIRSF:searchPIRSF017318PROSITE PROFILES:searchPS51169, SUPERFAMILY:searchSSF48600TIGRFAMS:searchTIGR01802UniProt:searchP32178
JMol viewer RasMol script viewer  TSA 400A  ..               *                                                                                                                                            *      *   *                       **    *  *                ..TSA ..                 *  **  *          
JMol viewer RasMol script viewer  TRP 300A  ..               |                                                      *  * *  *                  * *                                     *****  *           |      |   |                       ||    |  |                ..TRP ..                 |  ||  |          
sec str:  .......hhhh..hhhhhhhhhhhhhhhhhhhhhhhh....hhhh....hhh........hhhhhhhhhhhhhhhh.hhh........hhh..................hhh...hhhhhhhhhh.hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh..hhhhhhhhhhhhhhhhhh........ .......hhhhhhhhhh.hhhhhhhhhhhhhhhh...
sequence :  ..MDFTKPETVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFLDWALSNLEIAHSRIRRFESPDETPFFPDKIQKSFLPSINYPQILAPYAPEVNYNDKIKKVYIEKIIPLISKRDGDDKNNFGSVATRDIECLQSLSRRIHFGKFVAEAKFQSDIPLYTKLIKSKDVEGIMKNITNSAVEEKILERLTKKAEVYGVDPT... ..ERRITPEYLVKIYKEIVIPITKEVEVEYLLRRLEE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211    ... ..222       232       242       252  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||| ||       |   ||  ||    | || ||     ||| |||  ||||| |||| |  |^***|  |       | |  | ||| |..PS00001.. | ||           |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||| ||       |   ||  ||    | || ||     ||| |||  ||||| |||| |  | || |  |       | |  | ||| |..PS00004.. **^*           |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||^**|       |   ||  ||    ^**| ||     ||| |||  ||||| |||| |  | || |  |       ^**  | ||| ^..PS00005.. | |            |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | ^***|  |   ||   |  |         |  |    ^***  |  | |  |  ^***|  ^***||    ||| ^***    |  |  | |           || ||| | |  |     |||||^***       |   ||  ||      || ||     ||| |||  ||||| |||| |  | || ^***            | ||| |..PS00006.. | |            |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  ||  ||    ||| |  |    |  |  | |           || ||| | |  |     ||||||          |   ||  ||      || ||     |********^|||| |||| |  | ||                 | ||| |..PS00007.. | |            |   |******^|| |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  ||  ||    ||| |  |    |  |  | |           || ||| | |  |     ||||||          ^*****  ||      || ||     | | |||   |||| |||| ^*****|                 | ^****..PS00008.. | |            |   || |||  || |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  |*****    ||| |  |    |  |  | |           || ||| | |  |     *****|          |   |*****      || ||     | | |||   |||| ||||    |  |                 |  || |..alphabetamotif.. | |            |   ********** |   
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |   |  *****|   |  |         |  |    |  |  |  | |  |  |  ||  ||  |     ||| |  |    |  |  | |           || ||| | |  |     |||| |          |   ||  |       || ||     | | |||   |||| ||||    |  |                 |  || |..asxmotif.. | |            |   || |||  |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn .. ***   |  |    |   |  |         |  |    |  |  |  | |  |  |  ||  ||  |     ||| |  |    |  |  | |           || ||*** |  |     |||| |          |   ||  |       || ||     | | |||   |||| ||||    |  |                 |  |***..asxturn.. | |            |   || |||  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |  |    |   ****         |  |    |  |  **** ****  |  ||  |****     ||| |  |    |  |  | |           *****    ****     **** |          |   |****       *****     | ****|   |||****||    |  |                 |  |   ..betaturn.. | |            |   ************   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |  |    |                |  |    |  |       |  |  |  ||  |         ||| |  |    |  |  | |            |  |              ||  |          |   |                     |   | |   |||  |***    |  |                 |  |   ..gammaturn.. | |            |   |              
search RasMol script viewer Motif-ligand binding stats  nest ..       |  |    |                |  |    |  |       |  |  |  ||  |         *** |  |    |  |  | |            |  |              ||  |          |   |                     |   | |   |||  ***     |  |                 |  |   ..nest.. ***            |   |              
search RasMol script viewer Motif-ligand binding stats  niche ..       ****    |                ****    ****       ****  |  ||  |          *******    ****  | |            ****              |****          |   |                     |   | |   |||  | |     ****                 ****   ..niche..                |   |              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..               |                |                        |  ||  |                           | |                              |   |          |   |                     |   | |   ||******                                 ..schellmannloop..                |   |              
search RasMol script viewer Motif-ligand binding stats  stmotif ..               |                |                        *****  |                           | |                              |   |          |   |                     |   | |   ||   |                                   ..stmotif..                |   |              
search RasMol script viewer Motif-ligand binding stats  ststaple ..               |                |                           *****                           | |                              *****          *****                     ***** **********                                   ..ststaple..                *****              
search RasMol script viewer Motif-ligand binding stats  stturn ..               |                |                                                           ***                                                                                                                          ..stturn..                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..               *                *                                                                                                                                                                                        ..REP00000..                                   

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : CHORISMATE MUTASE
member of: CATH:search1.10.590.10GENE3D:searchG3DSA_1.10.590.10PANTHER:searchPTHR21145PFAM:searchPF01817PFAMB:searchPB002031PIRSF:searchPIRSF017318PROSITE PROFILES:searchPS51169, SUPERFAMILY:searchSSF48600TIGRFAMS:searchTIGR01802UniProt:searchP32178
JMol viewer RasMol script viewer  TSA 400B  ..               *                                                                                                                                            *      *   *                       **    *  *                ..TSA ..                 *  **  *          
JMol viewer RasMol script viewer  TRP 300B  ..               |                                                      *  * *  *                  * *                                     *****  *           |      |   |                       ||    |  |                ..TRP ..                 |  ||  |          
sec str:  .......hhhh..hhhhhhhhhhhhhhhhhhhhhhhh....hhhh....hhh........hhhhhhhhhhhhhhhh.hhh........hhh..................hhh...hhhhhhhhhh.hhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh..hhhhhhhhhhhhhhhhhh........ .......hhhhhhhhhh.hhhhhhhhhhhhhhhh...
sequence :  ..MDFTKPETVLNLQNIRDELVRMEDSIIFKFIERSHFATCPSVYEANHPGLEIPNFKGSFLDWALSNLEIAHSRIRRFESPDETPFFPDKIQKSFLPSINYPQILAPYAPEVNYNDKIKKVYIEKIIPLISKRDGDDKNNFGSVATRDIECLQSLSRRIHFGKFVAEAKFQSDIPLYTKLIKSKDVEGIMKNITNSAVEEKILERLTKKAEVYGVDPT... ..ERRITPEYLVKIYKEIVIPITKEVEVEYLLRRLEE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211    ... ..222       232       242       252  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||| ||       |   ||  ||    | || ||     ||| |||  ||||| |||| |  |^***|  |       | |  | ||| |..PS00001.. | ||           |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||| ||       |   ||  ||    | || ||     ||| |||  ||||| |||| |  | || |  |       | |  | ||| |..PS00004.. **^*           |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |  ||  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  || |||    ||| |  |    |  |  | |           || ||| | |  |     |||||^**|       |   ||  ||    ^**| ||     ||| |||  ||||| |||| |  | || |  |       ^**  | ||| ^..PS00005.. | |            |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | ^***|  |   ||   |  |         |  |    ^***  |  | |  |  ^***|  ^***||    ||| ^***    |  |  | |           || ||| | |  |     |||||^***       |   ||  ||      || ||     ||| |||  ||||| |||| |  | || ^***            | ||| |..PS00006.. | |            |   || ||| ||| |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  ||  ||    ||| |  |    |  |  | |           || ||| | |  |     ||||||          |   ||  ||      || ||     |********^|||| |||| |  | ||                 | ||| |..PS00007.. | |            |   |******^|| |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  ||  ||    ||| |  |    |  |  | |           || ||| | |  |     ||||||          ^*****  ||      || ||     | | |||   |||| |||| ^*****|                 | ^****..PS00008.. | |            |   || |||  || |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |   |  |   ||   |  |         |  |    |  |  |  | |  |  |  ||  |*****    ||| |  |    |  |  | |           || ||| | |  |     *****|          |   |*****      || ||     | | |||   |||| ||||    |  |                 |  || |..alphabetamotif.. | |            |   ********** |   
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |   |  *****|   |  |         |  |    |  |  |  | |  |  |  ||  ||  |     ||| |  |    |  |  | |           || ||| | |  |     |||| |          |   ||  |       || ||     | | |||   |||| ||||    |  |                 |  || |..asxmotif.. | |            |   || |||  |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn .. ***   |  |    |   |  |         |  |    |  |  |  | |  |  |  ||  ||  |     ||| |  |    |  |  | |           || ||*** |  |     |||| |          |   ||  |       || ||     | | |||   |||| ||||    |  |                 |  |***..asxturn.. | |            |   || |||  |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |  |    |   ****         |  |    |  |  **** ****  |  ||  |****     ||| |  |    |  |  | |           *****    ****     **** |          |   |****       *****     | ****|   |||****||    |  |                 |  |   ..betaturn.. | |            |   ************   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |  |    |                |  |    |  |       |  |  |  ||  |         ||| |  |    |  |  | |            |  |              ||  |          |   |                     |   | |   |||  |***    |  |                 |  |   ..gammaturn.. | |            |   |              
search RasMol script viewer Motif-ligand binding stats  nest ..       |  |    |                |  |    |  |       |  |  |  ||  |         *** |  |    |  |  | |            |  |              ||  |          |   |                     |   | |   |||  ***     |  |                 |  |   ..nest.. ***            |   |              
search RasMol script viewer Motif-ligand binding stats  niche ..       ****    |                ****    ****       ****  |  ||  |          *******    ****  | |            ****              |****          |   |                     |   | |   |||  | |     ****                 ****   ..niche..                |   |              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..               |                |                        |  ||  |                           | |                              |   |          |   |                     |   | |   ||******                                 ..schellmannloop..                |   |              
search RasMol script viewer Motif-ligand binding stats  stmotif ..               |                |                        *****  |                           | |                              |   |          |   |                     |   | |   ||   |                                   ..stmotif..                |   |              
search RasMol script viewer Motif-ligand binding stats  ststaple ..               |                |                           *****                           | |                              *****          *****                     ***** **********                                   ..ststaple..                *****              
search RasMol script viewer Motif-ligand binding stats  stturn ..               |                |                                                           ***                                                                                                                          ..stturn..                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..               *                *                                                                                                                                                                                        ..REP00000..                                   

   New search    3csm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML