triangle PDBeMotif: 3cmm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   6.3.2.19
Classification ligase/protein binding    | release date: Sun, Mar 23, 2008
Title crystal structure of the uba1-ubiquitin complex
Authors H.SCHINDELIN, I.LEE
Method X-RAY DIFFRACTION (resolution: 2.70Å)
PDBe Citation   
Small molecules:    search PRO PRO binding statistics PRO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C sequence:
AAGEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQ
KRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGLFGNTFVDLGD
EFTVLDPTGEEPRTGMVSDIEPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRIGSVKEYGEY
KKGGIFTEVKVPRKISFKSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDANELIKLVTDL
SVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKT
TQPVNSRYDNQIAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLFRPKD
VGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDARTYVDRRCVFYRKPLLESGTL
GTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSG
DVKGVLESISDSLSSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDIYNNDHFH
FVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDPDPNANAANGSDEIDQLVSSLPDPS
TLAGFKLEPVDFEKDDDTNHHIEFITACSNCRAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLELYKLIDNKT
DIEQYKNGFVNLALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYGVSLLYASFF
PPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFITIHL
Chains B,D sequence:
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UBIQUITIN-ACTIVATING ENZYME E1 1
member of: GENE3D:searchG3DSA_1.10.3240.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10953/searchPTHR10953_SF4PFAM:searchPF00899/searchPF02134/searchPF09358/searchPF10585PRINTS:searchUBIQUITINACTPROSITE PATTERNS:searchPS00536/searchPS00865, SMART:searchSM00985SUPERFAMILY:searchSSF69572TIGRFAMS:searchTIGR01408UniProt:searchP22515
JMol viewer RasMol script viewer  PRO 5119A  ..                                                                                                                                                                                                                                                                                                                *   *                                                                                                                                                                                                                                                                                                                                      ..PRO ..                                                                                                                                          ..                                                                                                                                                                                                                                    
sec str:  .....hhhhhhhhhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhh..eeeee.....hhhhhhh....hhhhh..hhhhhhhhhhh.......eee........hhhhh.eeee....hhhhhhhhhhhhhhhh.eeeeeeee..eeeeeee....eee.........eeeeeee....eeee............eeeee....hhhhhh...ee.eeee..eee..............eeee....eee...hhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......eeeee.hhhh...................hhhhhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhh.......eeeee.....hhhhh......hhhhh..hhhhhhhhhhhhhhhhhh..eeee....hhhhh...hhhhhhhh.eeee...hhhhhhhhhhhhhhhh..eeeeeee..eeeeeee......hhhhh........hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh... ...hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh............................hhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhh...........................hhhhhh...hhhhhh................hhhhhhhhhhhhhhhhh.....hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh...hhhhh.eeeee....eeeee......eeee..eeee....eeeee...hhhhhhhhhhhh...eeeeeee..eeeee...hhhhhhhhh..hhhhhhhhhh.........eeeeeeeee.....ee...eeeee.
sequence :  ..GEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDIEPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRIGSVKEYGEYKKGGIFTEVKVPRKISFKSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDANELIKLVTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQIAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLFRPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLK... ..DVKGVLESISDSLSSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDIYNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDPDP..EIDQLVSSLPDPSTLAGFKLEPVDFEKDDDTNHHIEFITACSNCRAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLELYKLIDNKTDIEQYKNGFVNLALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYGVSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFITIHL
seq num:  ..12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642  ... ..650       660       670       680       690       700       710       720       730       740       750       760       770       780     ..797       807       817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977       987       997       1007      1017    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | |               ||  |          |    |    | |   |  | |         |  |||||||| | | |  ||   | ||      | ||| |||||     |  ||  ||    | | ||||        |    |  |     |  | | ||      |  | | | | || | ||||  |   || || |  | | |               |||||   |||    |    | || || | | |  |    | |||                |  |     || ||  |   |   |  |  |    | ||   |        | |||        |    |  ||  | |  || |      | || |      | |  | | | || ||         ||  |       |    |       ||| |||||    ||^***       |  ||| || |^***      |  || |||||  | ||    |    ^***|| |             |  |     | |     |  | |      | |||  | ||||      | || |  |               |    |    | | ||  |   | |..PS00001..   | | |||| || |                          |  ||  |  |  |    | |   |  | |  |           | |   | | | |  |        | || |       |  |    |  |   ..     |||| | | || |       |  | |||||             | |            | |                     | |^***|| |      |  |         | |  |  |  ||| |              |  |  |||  ||   | | |||  |       |  |     ||  | ||               | |||           
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |               ||  |          |    |    | |   |  | |         |  |||||||| | | |  ||   | ||      | ||| |||||     |  ||  ||    | | ||||        |    |  |     |  | | ||      |  | | | | || | ||||  |   || || |  | | |               |||||   |||    |    **^* || | | |  |    | |||                |  |     || ||  |   |   |  |  |    | ||   |        | |||        |    |  ||  | |  || |      | || |      | |  | | | || ||         ||  |       |    |       ||| |||||    || |         |  ||| || |          |  || |||||  | ||    |      | || |             |  |     | |     |  | |      | |||  | ||||      | || |  |               |    |    | | ||  |   | |..PS00004..   | | |||| || |                          |  ||  |  |  |    | |   |  | |  |           | |   | | | |  |        | || |       |  |    |  |   ..     |||| | | || |       |  | |||||             | |            | |                     | ||||||| |      |  |         | |  |  |  ||| |              |  |  |||  ||   | | |||  |       |  |     ||  | ||               | |||           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |               ||  |          |    |    | |   |  | |         |  |^**|||| | | |  ||   | ||      | ||| |||||     |  ||  ||    | | ||||        |    |  |     |  | | ||      |  | | | | || | ||||  |   || || |  | | |               ^**||   |||    |       ^**^** | |  |    | |||                |  |     || ||  |   |   |  |  |    | ||   |        | |||        |    |  ||  ^**  || |      | || |      | |  | | | || ||         ||  |       |    |       ||| |||||    || |         |  ||| || |          |  || |||||  | ||    |      | || |             |  |     | |     |  | |      | |||  | ^**|      | |^**  |               |    |    | | ||  |   ^**..PS00005..   | | |||| |^**                          |  ||  |  |  |    | |   |  | |  |           ^**   | | | |  |        | || |       |  |    |  |   ..     |||| | | || |       |  | |||||             | |            | |                     | ||||||| |      |  |         ^**  |  |  ||| |              |  |  |||  ||   | | |||  |       |  |     ||  ^**|               | |||           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |               ||  |          |    |    | |   ^*** |         |  |^***||| | | |  ||   | ||      ^***| |||||     |  |^***|    | | ||||        |    ^***     ^*** ^***      ^*** | | ^*** | ||||  |   |^*** |  | | |               ^***|   |||    |          |   | ^***    | |||                |  |     |^***  |   |   |  |  |    | ||   |        | |||        |    |  ||  | |  || |      | ^***      | |  | | ^*** ||         ||  |       |    |       ||| ^***|    ^***         |  ||| || |          |  || |||||  | ||    |      ^*** |             ^***     | |     |  | |      | |||  | ^***      | |     |               |    |    | | ||  |   |  ..PS00006..   | | ^*** || |                          |  ||  |  ^***    | |   ^*** |  |                 | | | |  |        ^*** |       |  |    |  |   ..     ||^*** | || |       |  | |||||             | |            | |                     | |||^*** |      |  |              |  |  ||| |              |  |  |||  ||   | | |||  |       |  |     ||  ^***               | |||           
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   | |               ||  |          |    |    | |      | |         |  |||||||| | | |  *******^|      | | | |||||     |  ||   |    | | ||||        |    |             | |            | |   |  | ||||  |   |  |  |  | | |               ||| |   |||    |          |   |         | |||                |  |     |  |   |   |   |  |  |    | ||   |        | |||        |    |  ||  | |  || |      |  |        | |  | | | |  ||         ||  |       |    |       ||| ||| |     | |         |  ||| || |          |  || |||||  | ||    |        |  |                      | |     |  | |      | |||  |  |        | |     |               |    |    | | ||  |   |  ..PS00007..   | |  ||  || |                          |  ||  |          | |        |  |                 | | | |  |          |  |       |  |    |  |   ..     || | | | || |       |  | |||||             | |            | |                     | ||| ||  |      |  |              |  |  ||| |              |  |  |||  ||   | | |||  |       |  |     ||  |                  | |||           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |               ||  |          ^*****    | |      | |         |  ||||||^***** |  ||   |  |      | | | |||||     |  ||   |    | | ||||        ^*****             | |            | |   |  | |^*****   |  |  |  | | |               ||| |   ||^*****          |   |         | |||                |  |     |  |   |   |   |  |  |    | ^*****        | |||        ^*****  ||  | |  || |      |  |        | |  | | | |  ||         ||  |       ^*****       |^***** |     | |         |  ||| || |          |  || |||||  | ||    |        |  |                      | |     ^*****      | |||  |  |        | |     |               |    |    | | ||  |   |  ..PS00008..   ^*****|  || |                          |  ||  |          | |        |  |                 | | | |  |          |  |       |  |    |  |   ..     || | | | || |       |  | |||||             | |            | |                     | ||| ||  |      |  |              |  |  ||| |              |  |  |^*****   | | |||  |       |  |     ||  |                  | |||           
search RasMol script viewer Motif-ligand binding stats  RGD ..   | |               ||  |                    | |      | |         |  |||||| | *** |  ||   |  |      | | | |||||     |  ||   |    | | ||||                           | |            | |   |  | | ||  |   |  |  |  | | |               ||| |   ||                |   |         | |||                |  |     |  |   |   |   |  |  |    |  |            | ***                ||  | |  || |      |  |        | |  | | | |  ||         ||  |                    ||| ||  |     | |         |  ||| || |          |  || |||||  | ||    |        |  |                      | |        | |      | |||  |  |        | |     |               |    |    | | ||  |   |  ..PS00016..     |  ||  || |                          |  ||  |          | |        |  |                 | | | |  |          |  |       |  |    |  |   ..     || | | | || |       |  | |||||             | |            | |                     | ||| ||  |      |  |              |  |  ||| |              |  |  | |  ||   | | |||  |       |  |     ||  |                  | |||           
search RasMol script viewer Motif-ligand binding stats  UBIQUITIN_ACTIVAT_1 ..   | |               ||  |                    | |      | |         |  |||||| |     |  ||   |  |      | | | |||||     |  ||   |    | | ||||                           | |            | |   |  | | ||  |   |  |  |  | | |               ||| |   ||                |   |         | |||                |  |     |  |   |   |   |  |  |    |  |            |  |                 |*********| |      |  |        | |  | | | |  ||         ||  |                    ||| ||  |     | |         |  ||| || |          |  || |||||  | ||    |        |  |                      | |        | |      | |||  |  |        | |     |               |    |    | | ||  |   |  ..PS00536..     |  ||  || |                          |  ||  |          | |        |  |                 | | | |  |          |  |       |  |    |  |   ..     || | | | || |       |  | |||||             | |            | |                     | ||| ||  |      |  |              |  |  ||| |              |  |  | |  ||   | | |||  |       |  |     ||  |                  | |||           
search RasMol script viewer Motif-ligand binding stats  UBIQUITIN_ACTIVAT_2 ..   | |               ||  |                    | |      | |         |  |||||| |     |  ||   |  |      | | | |||||     |  ||   |    | | ||||                           | |            | |   |  | | ||  |   |  |  |  | | |               ||| |   ||                |   |         | |||                |  |     |  |   |   |   |  |  |    |  |            |  |                 |   | |   | |      |  |        | |  | | | |  ||         ||  |                    ||| ||  |     | |         |  ||| || |          |  || |||||  | ||    |        |  |                      | |        | |      | |||  |  |        **^******               |    |    | | ||  |   |  ..PS00865..     |  ||  || |                          |  ||  |          | |        |  |                 | | | |  |          |  |       |  |    |  |   ..     || | | | || |       |  | |||||             | |            | |                     | ||| ||  |      |  |              |  |  ||| |              |  |  | |  ||   | | |||  |       |  |     ||  |                  | |||           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |               ||  |                    | |      | |         |  |||||| |     *****   |  |      | | | |||||     |  ||   |    | *****|                           | |            | |   |  | | ||  |   |  |  |  | | |               ||| |   ||                |   |         | |||                |  |     |  |   |   |   |  |  |    |  |            |  |                 |   | |   | |      |  |        | |  | | | *****         ||  |                    ||| ||  |     | |         |  ||| || |          |  || |||||  | ||    |        |  |                      | |        | |      | |||  |  |                                |    |    | | ||  |   |  ..alphabetamotif..     *****  || |                          |  ||  |          | |        |  |                 | | | |  |          |  |       |  |    |  |   ..     || | | | || |       |  | |||||             | |            | |                     | ||| ||  |      |  |              |  |  ||| |              |  |  | |  ||   | | |||  |       |  |     ||  |                  | |||           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | |               ||  |                    | |      | |         |  |||||| |     |  |    |  |      | | | |||||     |  ||   |    | | || |                           | |            | |   |  | | ||  |   |  |  |  | | |               ||| |   ||                |   |         *****                |  |     |  *****   |   |  |  |    |  |            |  |                 |   | |   | |      |  |        | |  | | | |  |          ||  |                    ||| ||  |     | |         |  ||| || |          |  || |||||  | ||    |        |  |                      | |        | |      | |||  |  |                                |    |    | | ||  |   |  ..asxmotif..     |  ||  || |                          |  ||  |          | |        |  |                 | | | |  |          |  |       |  |    |  |   ..     || | | | || |       |  | |||||             | |            | |                     | ||| ||  |      |  |              |  |  ||| |              |  |  | |  ||   | | |||  |       |  |     ||  |                  *****           
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ***               ||  |                    | |      | |         |  |||||| |     |  |    |  |      | | | |||||     |  ||   |    | | || |                           | |            | |   |  | | ||  |   |  |  |  | | |               ||| |   ||                |   |         ***|                 |  |     |  |       |   |  |  |    |  |            |  |                 |   | |   | |      |  |        ***  | | | |  |          ||  |                    ||| ||  |     ***         |  ||| || |          |  || |||||  | ||    |        |  |                      | |        | |      | |||  |  |                                |    |    | | ||  |   |  ..asxturn..     |  ||  || |                          |  ||  |          | |        |  |                 | | | |  |          |  |       |  |    |  |   ..     || | *** || |       |  ***||||             | |            | |                     | ||| ||  |      |  |              |  |  *** |              |  |  | |  ||   | | |||  |       |  |     ||  |                  ***||           
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     ||  |                    | |      | |         |  |||||| |     |  |    |  |      | | | |||||     |  ||   |    | | || |                           | |            | |   |  | | ||  |   |  |  |  | | |               ||| |   **                |   |         |  |                 |  |     |  |       |   |  |  |    |  |            |  |                 |   | |   | |      |  |          |  | | | |  |          ||  |                    ||| ||  |     | |         |  ||| || |          |  || |||||  | ||    |        |  |                      | |        | |      | |||  |  |                                |    |    | | ||  |   |  ..betabulge..     |  ||  || |                          |  ||  |          | |        |  |                 | | | |  |          |  |       |  |    |  |   ..     || |   | || |       |  |  ||||             | |            | |                     | ||| ||  |      |  |              |  |   |  |              |  |  | |  **   | | **|  |       |  |     ||  |                  | |||           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                     ||  |                    | |      | |         |  |||||| |     |  |    |  |      | | | |||||     |  ||   |    | | || |                           | |            | |   |  | | ||  |   |  |  |  | | |               ||| |                     |   |         |  |                 |  |     |  |       |   |  |  |    |  |            |  |                 |   | |   | |      |  |          |  | | | |  |          ||  |                    ||| ||  |     | |         |  ||| || |          |  || |||||  | ||    |        |  |                      | |        | |      | |||  |  |                                |    |    | | ||  |   |  ..betabulgeloop..     |  ||  || |                          |  ||  |          | |        |  |                 | | | |  |          |  |       |  |    |  |   ..     || |   | || |       |  |  ||||             | |            | |                     | ||| ||  |      |  |              |  |   |  |              |  |  | |       | |   |  |       |  |     ||  |                  *****           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     |****                    | |      | |         |  ||||****     ****    |  |      | | | ****|     |  ||   |    | **** |                           | |            | |   **** | |****   |  |  **** | |               |****                     |   |         ****                 ****     |  |       |   |  |  |    |  |            ****                 |   | |   | |      |  |          |  | | | ****          ||  |                    ||| ||  |     | |         ***********          |  *******|  | ||    |        |  |                      | |        | |      ****|  |  |                                |    |    | | ||  |   |  ..betaturn..     ********| |                          |  ||  |          | |        ****                 | | | ****          |  |       |  |    |  |   ..     ****   | ****       |  |  ||||             | |            | |                     ****| ||  |      |  |              ****   |  |              ****  | |       | |   ****       |  |     ||  |                  ****|           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                     ||  |                    | |      | |         |  |||||| |             |  |      | | |  || |     |  ||   |    |   || |                           | |            | |        | ||  |   |  |       | |               | |                       |   |                                       |  |       |   |  |  |    |  |            |  |                 |   | |   ***      |  |          |  | | | |             ||  |                    ||| ||  |     | |         |  | | || |          |  ||  || |  | ||    |        |  |                      | |        | |        | |  |  |                                |    |    | | ||  |   |  ..gammaturn..             | |                          |  ||  |          | |        |  |                 | | | |  |          |  |       |  |    |  |   ..      | |   | || |       |  |  ||||             | |            | |                       | | ||  |      |  |                     |  |                    | |       | |   |  |       |  |     ||  |                    | |           
search RasMol script viewer Motif-ligand binding stats  nest ..                     ||  |                    ***      | |         |  |||||| |             |  |      | | |  || |     |  ||   |    |   |***                           ***            ***        ***|  |   |  |       ***               | |                       |   |                                       |  |       |   |  |  |    |  |            |  |                 |   ***            |  |          |  | *** |             ||  |                    *** ||  |     | |         |  | | || |          |  ||  |***  | ||    |        |  |                      ***        | |        ***  |  |                                |    |    | | ||  |   |  ..nest..             | |                          |  ||  |          | |        |  |                 *** | |  |          |  |       |  |    |  |   ..      | |   | || |       |  |  ****             ***            ***                       *** ||  |      |  |                     |  |                    ***       | |   |  |       |  |     ||  |                    ***           
search RasMol script viewer Motif-ligand binding stats  niche ..                     |****                             ***         ****|******             ****      *** |  ****     ****|   |    |   |                              | |                          ****   ****                         | |                       |   |                                       ****       |   |  ****    ****            ****                 |   | |            ****          ****   | |             |****                     ********     ***         **** ******          ********     ***|    |        ****                                 ***             ****                                |    |    | ****  |   |  ..niche..             ***                          ********          ***        ****                     | ****          ****       ****    ****   ..      ***   ******       ****                                                              *******      ****                     ****                              ***   ****       ****     |****                                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                     |   |                                             | |                               |   |           *****    |   |                              | |                                                              | |                       *****                                                  |   |                                               |   | |                                 | |             |   |                                                                                   |    |                                                                                                 |    |    |   |   |   |  ..stmotif..                                                                                                | |                                       ..                                                                                                                                                                                             |   |                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     *****                                             | |                               *****                    *****                              | |                                                              | |                                                                              *****                                               ***** |                                 | |             *****                                                                                   ******                                                                                                 ******    *****   *****  ..ststaple..                                                                                                | |                                       ..                                                                                                                                                                                             *****                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                       ***                                                                                           ***                                                              ***                                                                                                                                      ***                                 ***                                                                                                                                                                                                                                     ..stturn..                                                                                                ***                                       ..                                                                                                                                                                                                                                    

chain B : UBIQUITIN
member of: GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10666PFAM:searchPF00240PFAMB:searchPB000455/searchPB001954/searchPB004031/searchPB006228/searchPB010316/searchPB012590/searchPB012629PROSITE PATTERNS:searchPS00299, PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP0CG63
sec str:  ...eeeeee....eeeee.....hhhhhhhhhhhhhh.hhhhheeee..ee......hhhhh.....eeeee......
sequence :  ..MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
seq num:  ..1         11        21        31        41        51        61        71    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | ^**      |  |  |  ||     | | |  |   |  |   | || ||||||  |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |||      |  |  |  ||     | | |  |   |  |   | |^***||||  |           
search RasMol script viewer Motif-ligand binding stats  UBIQUITIN_1 ..      | |||      |  |  |  ************************** |  | ||||  |           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      *****      |  |  |   |     | | |  |   |  |   | |  | ||||  |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|      ****  |   |     | | ****   ****   | |  ****||  |           
search RasMol script viewer Motif-ligand binding stats  nest ..        ***      |  |  |   |     *** |  |          | |    ***|  |           
search RasMol script viewer Motif-ligand binding stats  niche ..                 ****  |   |         ****          ***       ****           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       *****                                                

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : UBIQUITIN-ACTIVATING ENZYME E1 1
member of: GENE3D:searchG3DSA_1.10.3240.10/searchG3DSA_3.40.50.720PANTHER:searchPTHR10953/searchPTHR10953_SF4PFAM:searchPF00899/searchPF02134/searchPF09358/searchPF10585PRINTS:searchUBIQUITINACTPROSITE PATTERNS:searchPS00536/searchPS00865, SMART:searchSM00985SUPERFAMILY:searchSSF69572TIGRFAMS:searchTIGR01408UniProt:searchP22515
JMol viewer RasMol script viewer  PRO 5129C  ..                                                                                                                                                                                                                                                                                                                 *   *  *                         *                                                                                                                                                                                                                                                                                                                                                                                                                                                    ..PRO ..                                                                                                                                                                                                                                       
sec str:  ......hhhhhhhhhh..hhhhhhhhh..eeeee..hhhhhhhhhhhhhhh..eeeee.....hhhhhhh....hhhhh..hhhhhhhhhhhh......eee.....hhhhhhhh.eeee....hhhhhhhhhhhhhhhh.eeeeeeee..eeeeeee....eee.........eeeeeee....eeee............eeeee....hhhhhh...ee.eeee..eee..............eeeee...eee...hhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......eeeee.hhhh...................hhhhhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhhhh.......eeeee.....hhhhh......hhhhh..hhhhhhhhhhhhhhhhhh..eeee....hhhhh...hhhhhhhh.eeee...hhhhhhhhhhhhhhh...eeeeeee..eeeeeee......hhhhh........hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh............................hhhhhhhhhhhhhhhhhhh.....hhhhh.hhhhhhhhhhh........................ ......hhhhhhhh.hhhhh.................hhhhhhhhhhhhhhhhhh....hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh...hhhhh.eeeee....eeeee......eeee..eeee....eeeee...hhhhhhhhhhhh...eeeeeee..eeeee...hhhhhhhhh..hhhhhhhhhh.........eeeeeeeee.....ee...eeeee.
sequence :  ..AGEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDIEPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRIGSVKEYGEYKKGGIFTEVKVPRKISFKSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDANELIKLVTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQIAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLFRPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSGDVKGVLESISDSLSSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDIYNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDP... ..GSDEIDQLVSSLPDPSTLAGFKLEPVDFEKDDDTNHHIEFITACSNCRAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLELYKLIDNKTDIEQYKNGFVNLALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYGVSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFITIHL
seq num:  ..11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781  ... ..794       804       814       824       834       844       854       864       874       884       894       904       914       924       934       944       954       964       974       984       994       1004      1014       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |    |  |       || ||          |    |    | |   |  | |         |  |||||||| | | |  |    | ||      || |   |  |     |  ||  ||    | | ||||        |    |  |     |  | | ||      || | ||| | || | ||||  |   || || |  |           |  |    |||||     |    |    | || || |   |  |       |  |              |  |     || ||  |   |   |          | ||   |        | |||        |    |  ||  |||  || |     || || | |    | | ||   | || || ||      ||  |       |    |       |||||||||    ||^***       |  ||| || |^***      |  ||  || |     |    |    ^***||||             |  |     | |     | || |      | |||  | ||||      | || |  | |  ||                   | | || |||  ||| |    |   |||| || |                        |  || |  |  || || | | |   |  | |  |   |       | |   | | | |           | || |       |  |    |  | ..PS00001..***     | || | |  |         |  |  ||||   |         | |   |   | || |||             |  ||  || |^***|| |      |  |         | |        ||| |                     |    |   | | |||  |       |  |         | || | |             | |           
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    | |    |  |       || ||          |    |    | |   |  | |         |  |||||||| | | |  |    | ||      || |   |  |     |  ||  ||    | | ||||        |    |  |     |  | | ||      || | ||| | || | ||||  |   || || |  |           |  |    |||||     |    |    **^* || |   |  |       |  |              |  |     || ||  |   |   |          | ||   |        | |||        |    |  ||  |||  || |     || || | |    | | ||   | || || ||      ||  |       |    |       |||||||||    || |         |  ||| || |          |  ||  || |     |    |    | | ||||             |  |     | |     | || |      | |||  | ||||      | || |  | |  ||                   | | || |||  ||| |    |   |||| || |                        |  || |  |  || || | | |   |  | |  |   |       | |   | | | |           | || |       |  |    |  | ..PS00004..        | || | |  |         |  |  ||||   |         | |   |   | || |||             |  ||  || ||||||| |      |  |         | |        ||| |                     |    |   | | |||  |       |  |         | || | |             | |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |    |  |       || ||          |    |    | |   |  | |         |  |^**|||| | | |  |    | ||      || |   |  |     |  ||  ||    | | ||||        |    |  |     |  | | ||      || | ||| | || | ||||  |   || || |  |           |  |    ^**||     |    |       ^**^**   |  |       |  |              |  |     || ||  |   |   |          | ||   |        | |||        |    |  ||  ^**  || |     || || | |    | | ||   | || || ||      ||  |       |    |       |||||||||    || |         |  ||| || |          |  ||  || |     |    |    | | ||||             |  |     | |     | || |      | |||  | ^**|      | |^**  | |  ||                   | | || |||  ^** |    |   |||| |^**                        |  || |  |  || || | | |   |  | |  |   |       ^**   | | | |           | || |       |  |    |  | ..PS00005..        | || | |  |         |  |  ||||   |         | |   |   | || |||             |  ||  || ||||||| |      |  |         ^**        ||| |                     |    |   | | |||  |       |  |         ^**| | |             | |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |    |  |       || ||          |    |    | |   ^*** |         |  |^***||| | | |  |    | ||      ^***   |  |     |  |^***|    | | ||||        |    ^***     ^*** ^***      ^*** ||| ^*** | ||||  |   |^*** |  |           |  |    ^***|     |    |                ^***       |  |              |  |     |^***  |   |   |          | ||   |        | |||        |    |  ||  |||  || |     || ^*** |    | | ||   ^*** || ||      ||  |       |    |       ||||^***|    ^***         |  ||| || |          |  ||  || |     |    |    | ^***||             ^***     | |     | || |      | |||  | ^***      | |     | |  ||                   | | || |||  ||  |    |   ^*** || |                        |  || |  |  ^***| | | |   ^*** |  |   |             | | | |           ^*** |       |  |    |  | ..PS00006..        | ^*** |  |         |  |  ||||   |         | |   |   | || |||             |  ||  || |||^*** |      |  |                    ||| |                     |    |   | | |||  |       |  |         ^*** | |             | |           
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    | |    |  |       || ||          |    |    | |      | |         |  |||||||| | | |  *******^|       | |   |  |     |  ||   |    | | ||||        |    |             | |       || | |||   || | ||||  |   |  |  |  |           |  |     |  |     |    |                           |  |              |  |     |  |   |   |   |          | ||   |        | |||        |    |  ||  |||  || |     || || | |    | | ||   | |  || ||      ||  |       |    |       |||| || |     | |         |  ||| || |          |  ||  || |     |    |    | | | ||                      | |     | || |      | |||  |  |        | |     | |  ||                   | | || |||  ||  |    |    ||  || |                        |  || |  |   | || | | |        |  |   |             | | | |             |  |       |  |    |  | ..PS00007..        |  | | |  |         |  |  ||||   |         | |   |   | || |||             |  ||  || ||| ||  |      |  |                    ||| |                     |    |   | | |||  |       |  |         | |  | |             | |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |    |  |       || ||          ^*****    | |      | |         |  ||||||^***** |       |  |       | |   |  |     |  ||   |    | | ||||        ^*****             | |       || | |||   || | |^*****   |  |  |  |           |  |     |  |     ^*****                           |  |              |  |     |  |   |   |   |          | ^*****        | |||        ^*****  ||  |||  || |     || || | |    | | ||   | |  || ||      ||  |       ^*****       |^***** |     | |         |  ||| || |          |  ||  || |     |    |    | | | ||                      | |     ^*****      | |||  |  |        | |     | |  ||                   | | || |||  ||  |    ^*****|  || |                        |  || |  |   | || | | |        |  |   |             | | | |             |  |       |  |    |  | ..PS00008..        |  | | |  |         |  |  ||||   |         | |   |   | || |||             |  ||  || ||| ||  |      |  |                    ||| |                     ^*****   | | |||  |       |  |         | |  | |             | |           
search RasMol script viewer Motif-ligand binding stats  RGD ..    | |    |  |       || ||                    | |      | |         |  |||||| | *** |       |  |       | |   |  |     |  ||   |    | | ||||                           | |       || | |||   || | | ||  |   |  |  |  |           |  |     |  |                                      |  |              |  |     |  |   |   |   |          |  |            | ***                ||  |||  || |     || || | |    | | ||   | |  || ||      ||  |                    | || |  |     | |         |  ||| || |          |  ||  || |     |    |    | | | ||                      | |       || |      | |||  |  |        | |     | |  ||                   | | || |||  ||  |          |  || |                        |  || |  |   | || | | |        |  |   |             | | | |             |  |       |  |    |  | ..PS00016..        |  | | |  |         |  |  ||||   |         | |   |   | || |||             |  ||  || ||| ||  |      |  |                    ||| |                              | | |||  |       |  |         | |  | |             | |           
search RasMol script viewer Motif-ligand binding stats  UBIQUITIN_ACTIVAT_1 ..    | |    |  |       || ||                    | |      | |         |  |||||| | |   |       |  |       | |   |  |     |  ||   |    | | ||||                           | |       || | |||   || | | ||  |   |  |  |  |           |  |     |  |                                      |  |              |  |     |  |   |   |   |          |  |            |  |                 |*********| |     || || | |    | | ||   | |  || ||      ||  |                    | || |  |     | |         |  ||| || |          |  ||  || |     |    |    | | | ||                      | |       || |      | |||  |  |        | |     | |  ||                   | | || |||  ||  |          |  || |                        |  || |  |   | || | | |        |  |   |             | | | |             |  |       |  |    |  | ..PS00536..        |  | | |  |         |  |  ||||   |         | |   |   | || |||             |  ||  || ||| ||  |      |  |                    ||| |                              | | |||  |       |  |         | |  | |             | |           
search RasMol script viewer Motif-ligand binding stats  UBIQUITIN_ACTIVAT_2 ..    | |    |  |       || ||                    | |      | |         |  |||||| | |   |       |  |       | |   |  |     |  ||   |    | | ||||                           | |       || | |||   || | | ||  |   |  |  |  |           |  |     |  |                                      |  |              |  |     |  |   |   |   |          |  |            |  |                 ||  |||   | |     || || | |    | | ||   | |  || ||      ||  |                    | || |  |     | |         |  ||| || |          |  ||  || |     |    |    | | | ||                      | |       || |      | |||  |  |        **^****** |  ||                   | | || |||  ||  |          |  || |                        |  || |  |   | || | | |        |  |   |             | | | |             |  |       |  |    |  | ..PS00865..        |  | | |  |         |  |  ||||   |         | |   |   | || |||             |  ||  || ||| ||  |      |  |                    ||| |                              | | |||  |       |  |         | |  | |             | |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |    |  |       || ||                    | |      | |         |  |||||| | |   |       |  |       | |   |  |     |  ||   |    | *****|                           | |       || | |||   || | | ||  |   |  |  |  |           |  |     |  |                                      |  |              |  |     |  |   |   |   |          |  |            |  |                 |*****|   | |     || || | |    | | ||   | ********      ||  |                    | || |  |     | |         |  ||| || |          |  ||  || |     |    |    | | | ||                      | |       || |      | |||  |  |                  *****                   | | || |||  ||  |          |  || |                        ***** |  |   | || | | |        |  |   |             | | | |             |  |       |  |    |  | ..alphabetamotif..        |  | | |  |         |  |  ||||   |         | |   |   | || |||             ********* ||| ||  |      |  |                    ||| |                              | | |||  |       |  |         | |  | |             | |           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |    |  |       || ||                    | |      | |         |  |||||| | |   |       |  |       | |   |  |     |  ||   |    | | || |                           | |       || | |||   || | | ||  |   |  |  |  |           |  |     |  |                                      |  |              |  |     |  *****   |   |          |  |            |  |                 ||  | |   | |     || || | |    *****|   | |  |  |       ||  |                    | || |  |     | |         |  ||| || |          |  ||  || |     |    |    ***** ||                      | |       || |      | |||  |  |                  |  |                    | | || |||  ||  |          |  || |                        |  |  |  |   | || | | |        |  *****             | | | |             |  |       |  |    |  | ..asxmotif..        |  | | |  |         |  |  ||||   |         | |   ***** || |||             |  ||  || ||| ||  |      |  |                    ||| |                              | | |||  |       |  |         | |  | |             | |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..    ***    |  |       || ||                    | |      ***         |  |||||| | |   |       |  |       | |   |  |     |  ||   |    | | || |                           | |       || | ***   || | | ||  |   |  |  |  |           |  |     |  |                                      |  |              |  |     |  |       |   |          |  |            |  |                 ||  | |   | |     || || ***    *** ||   | |  |  |       ||  |                    | || |  |     ***         |  ||| || |          |  ||  || |     |    |      | | ||                      | |       || |      | |||  |  |                  |  |                    | | || |||  ||  |          |  || |                        |  |  |  |   | || | | |        |  |                 | | | |             |  |       |  |    |  | ..asxturn..        |  | ***  |         |  |  ||||   |         | |         || |||             |  ||  || ||| ||  |      |  |                    *** |                              | | |||  |       |  |         | |  | |             | |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |  |       || ||                    | |      | |         |  |||||| | |   |       |  |       | |   |  |     |  ||   |    | | || |                           | |       ** | |||   || | | ||  |   |  |  |  |           |  |     |  |                                      |  |              |  |     |  |       |   |          |  |            |  |                 ||  | |   | |     || ||        | | ||   | |  |  |       ||  |                    | || |  |     | |         |  ||| || |          |  ||  || |     |    |      | | ||                      | |       || |      | |||  |  |                  |  |                    | | || |||  ||  |          |  || |                        |  |  |  |   | || | | |        |  |                 | | | |             |  |       |  |    |  | ..betabulge..        |  |   |  |         |  |  ||||   |         | |         || |||             |  ||  || ||| ||  |      |  |                     |  |                              | | **|  |       |  |         | |  | |             | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****       ****|                    | |      | |         |  |****| | |   |       |  |       | |   |  |     ****|   |    | **** |                           | |          ****|   **** | |****   |  |  ****           |  |     ****                                      ****              ****     ****       |   |          |  |            |  |                 |**** |   | |     ****|        | | ||   | *******       ||  |                    | || ****     | |         ********| |          |  ||  || |     |    |      | | ||                      | |       ****      ****|  |  |                  ****                    | | || |||  ||  |          |  || |                        ****  |  |   | || | | |        ****                 | | | |             |  |       |  |    |  | ..betaturn..        |  |   |  |         |  |  ||||   |         | |         |****|             ************| ||  |      |  |                     |  |                              | |   |  |       |  |         | |  | |             | |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                       |  |                    | |      | |         |  |||||| | |   |       |  |       | |   |  |     |  ||   |    |   || |                           | |            | |    | | | ||  |   |  |                 |  |                                                                          |  |       |   |          |  |            |  |                 |   | |   ***      |  |        | | ||   | |             ||  |                    | || |  |     | |         |  | | || |          |  ||  || |     |    |      | | ||                      | |        | |        | |  |  |                                          | | || |||  ||  |          |  || |                              |  |   | || | | |        |  |                 | | | |             |  |       |  |    |  | ..gammaturn..        |  |   |  |         |  |  ||||   |         | |         |  | |                       | | ||  |      |  |                     |  |                              | |   |  |       |  |         ***  ***             | |           
search RasMol script viewer Motif-ligand binding stats  nest ..                       |  |                    ***      | |         |  |||||| | |   |       |  |       | |   |  |     |  ||   |    |   |***                           | |            ***    | | ***|  |   |  |                 |  |                                                                          |  |       |   |          |  |            |  |                 |   ***            |  |        | | ||   | |             ||  |                    ******  |     | |         |  | | || |          |  ||  |***     |    |      | | ||                      ***        | |        ***  |  |                                          | | || ***  ||  |          |  || |                              |  |   ***| | | |        |  |                 *** | |             |  |       |  |    |  | ..nest..        |  |   |  |         |  |  ****   |         ***         |  ***                       *** ||  |      |  |                     |  |                              | |   |  |       |  |                              ***           
search RasMol script viewer Motif-ligand binding stats  niche ..                       ****                             ***         ****|****** |   |       ****       ***   ****     ****|   |    |   |                              ***                   ***    ****   ****                 ****                                                                          ****       |   |          ****            ****                 |   | |            ****        | ****   | |             |****                       ******     ***         **** ******          ********        |    |      | ****                                 ***             ****                                          | ****  |   |****          |  ****                              ****      *** ***        ****                     ***             ****       ****    **** ..niche..        ****   ****         ****     |   |                     |    |                         *******      ****                     ****                              ***   ****       ****                                            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                        | | |   |   |                                     |   |    |   |                              | |                                                                                                                                               |   |                                               |   | |                        |   |    | |             |   |                                                                                   |    |      |   |                                                                                                |   |   |   |              |   |                                                                                                                          ..schellmannloop..                                     |   |                     ******                                                                                                                                                                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                        *****   |   |                                     *****    |   |                              | |                                                                                                                                               |   |                                               |   | |                        |   |    | |             |   |                                                                                   |    |      |   |                                                                                                |   |   |   |              |   |                                                                                                                          ..stmotif..                                     |   |                                                                                                                                                                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                        | |     *****                                              *****                              | |                                                                                                                                               *****                                               ***** |                        *****    | |             *****                                                                                   ******      *****                                                                                                *****   *****              *****                                                                                                                          ..ststaple..                                     *****                                                                                                                                                                                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                        ***                                                                                           ***                                                                                                                                                                                                       ***                                 ***                                                                                                                                                                                                                                                                                                                                                                                ..stturn..                                                                                                                                                                                                                                       

chain D : UBIQUITIN
member of: GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10666PFAM:searchPF00240PFAMB:searchPB000455/searchPB001954/searchPB004031/searchPB006228/searchPB010316/searchPB012590/searchPB012629PROSITE PATTERNS:searchPS00299, PROSITE PROFILES:searchPS50053, SMART:searchSM00213SUPERFAMILY:searchSSF54236UniProt:searchP0CG63
sec str:  ...eeeeee....eeeee.....hhhhhhhhhhhhhh.hhhhh.eee..ee......hhhhh.....eeee.......
sequence :  ..MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
seq num:  ..1         11        21        31        41        51        61        71    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | ^**      |  ||   ||      | | |  |   |  |  || || ||||||  |           
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |||      |  ||   ||      | | |  |   |  |  || |^***||||  |           
search RasMol script viewer Motif-ligand binding stats  UBIQUITIN_1 ..      | |||      |  ||   |************************** |  | ||||  |           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      *****      |  ||   |       | | |  |   |  |  |  |  | ||||  |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|      ****|   |       | | |  |   ****  |  |  ****|****           
search RasMol script viewer Motif-ligand binding stats  nest ..        ***      |  ||   |       *** |  |         |  |    ***|  |           
search RasMol script viewer Motif-ligand binding stats  niche ..                 ****|   |           ****         ****       ****           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                     *****                                                  

   New search    3cmm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors