triangle PDBeMotif: 3bun  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   6.3.2.
Classification ligase/signaling protein    | release date: Thu, Jan 3, 2008
Title crystal structure of c-cbl-tkb domain complexed with its binding motif in sprouty4
Authors C.NG, G.R.GUY, J.P.BUSCHDORF, J.SIVARAMAN, Q.SUN, R.A.JACKSON
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Modified residues:  search PTR PTR binding statistics PTR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SHVENDYIDNPSL
Chain B sequence:
GSLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRY
EGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRIT
KADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLA
VTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDG
RNQNPDLTG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : 13-MERIC PEPTIDE FROM PORTEIN SPROUTY HOMOLOG 4
member of: PANTHER:searchPTHR12365/searchPTHR12365_SF4UniProt:searchQ9C004
sec str:  .........
sequence :  ..NDYIDNP
seq num:  ..51     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : E3 UBIQUITIN-PROTEIN LIGASE CBL
member of: CATH:search1.10.238.10/search1.20.930.20/search3.30.505.10GENE3D:searchG3DSA_1.10.238.10/searchG3DSA_1.20.930.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR23007/searchPTHR23007_SF5PFAM:searchPF02262/searchPF02761/searchPF02762PROSITE PROFILES:searchPS51506, SUPERFAMILY:searchSSF47473/searchSSF47668/searchSSF55550UniProt:searchP22681
sec str:  ......hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh...hhhhhhhhhhhhh...eeehhhhhhhhhhhh...hhhhhhhhhhhhh.....eeehhhhhhhhhhh.hhhhhhhhhhhhh..........hhhhhhhhhhh......eeeeee.......eeeeee.....eeee.....hhhhhhhhhhhh....ee...........
sequence :  ..PGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTG
seq num:  ..48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                     |  | || || |                  || ||    || ||   |     |  ||  |    | |  | ||  |   |^*** |           |    |   | |||||| |         | |      | |  || ||   |  |  |  || | ||||| |  ||   ||  | |  |       |  |  |    |  |    || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                     |  | || || |                  || ||    || ||   |     |  ||  |    | |  | ||  |   | |   |           |    |   | ^**||| |         | |      ^**  || ||   |  |  |  || | ||||| |  ||   ||  | |  |       |  |  |    |  |    || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                     |  | || || |                  |^***    ^***|   |     |  ||  |    | |  | ||  |   | |   |           |    |   |  | |^***         | |           || ||   ^***  |  ^*** ^***| ^***|   ||  | |  |       |  |  |    ^***    || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                     |  | || || |                  || ||     |  |   |     |  ||  |    *******^|  |   | |   |           |    |   |  | | |           | |           || ||         |   | | |||||     |   ||  | |  |       |  |  |            || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                     |  | || || |                  || ||     |  |   |     |  ||  |      |  |  |  |   | |   |           ^*****   |  | | |           | |           || ||         |   | | |||||     |   ||  | |  |       |  |  |            || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     |  | || || |                  || ||     |  |   |     |  ||  |      |  |  |  |   | |   |                    |  | | |           | |           *****         |   | | |||||     |   ||  | |  |       |  |  |            || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                     |  | || || |                  || ||     |  *****     |  ||  |      |  |  |  |   | |   |                    |  | | |           | |           || ||         |   | | |||||     |   ||  | |  |       |  |  |            || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..                     |  ***| || |                  || ||     |  |         |  ||  |      |  |  |  |   | |   |                    |  | | |           | |           || ||         |   | | |||||     |   ||  | |  |       |  |  |            || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     |  |  | || |                  ****|     ****         |  ||  |      **********   | |   |                    |  | | |           | |           ****|         |   | ****|||     |   ||  | ****       |  |  |            **********        ****        | |                 |****||  **** |      
search RasMol script viewer Motif-ligand binding stats  nest ..                     |  |  ***| |                   |  |     |  |         |  ||  |         |  |  |   | |   |                    |  | | |           | |            |  |         |   |   *****     |   ||  |            |  |  |                  |  |        |  |        ***                 |  ****     | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                     ****     ***                   ****     ****         |  ||  |         *******   | |   |                    **** ***           ***            ****         |   |             |   |****            *******                  ****        ****                            |    |      ***      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                          |  ||  |               |   | |   |                                                                   |   |             |   |                                                                                     ******               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                          |  ||  |               ***** |   |                                                                   |   |             |   |                                                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                          ********                     *****                                                                   *****             *****                                                                                                          

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : 13-MERIC PEPTIDE FROM PORTEIN SPROUTY HOMOLOG 4
member of: PANTHER:searchPTHR12365/searchPTHR12365_SF4UniProt:searchQ9C004
sec str:  .........
sequence :  ..NDYIDNP
seq num:  ..51     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       

chain B : E3 UBIQUITIN-PROTEIN LIGASE CBL
member of: CATH:search1.10.238.10/search1.20.930.20/search3.30.505.10GENE3D:searchG3DSA_1.10.238.10/searchG3DSA_1.20.930.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR23007/searchPTHR23007_SF5PFAM:searchPF02262/searchPF02761/searchPF02762PROSITE PROFILES:searchPS51506, SUPERFAMILY:searchSSF47473/searchSSF47668/searchSSF55550UniProt:searchP22681
sec str:  ......hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh...hhhhhhhhhhhhh...eeehhhhhhhhhhhh...hhhhhhhhhhhhh.....eeehhhhhhhhhhh.hhhhhhhhhhhhh..........hhhhhhhhhhh......eeeeee.......eeeeee.....eeee.....hhhhhhhhhhhh....ee...........
sequence :  ..PGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTG
seq num:  ..48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                     |  | || || |                  || ||    || ||   |     |  ||  |    | |  | ||  |   |^*** |           |    |   | |||||| |         | |      | |  || ||   |  |  |  || | ||||| |  ||   ||  | |  |       |  |  |    |  |    || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                     |  | || || |                  || ||    || ||   |     |  ||  |    | |  | ||  |   | |   |           |    |   | ^**||| |         | |      ^**  || ||   |  |  |  || | ||||| |  ||   ||  | |  |       |  |  |    |  |    || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                     |  | || || |                  |^***    ^***|   |     |  ||  |    | |  | ||  |   | |   |           |    |   |  | |^***         | |           || ||   ^***  |  ^*** ^***| ^***|   ||  | |  |       |  |  |    ^***    || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                     |  | || || |                  || ||     |  |   |     |  ||  |    *******^|  |   | |   |           |    |   |  | | |           | |           || ||         |   | | |||||     |   ||  | |  |       |  |  |            || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                     |  | || || |                  || ||     |  |   |     |  ||  |      |  |  |  |   | |   |           ^*****   |  | | |           | |           || ||         |   | | |||||     |   ||  | |  |       |  |  |            || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     |  | || || |                  || ||     |  |   |     |  ||  |      |  |  |  |   | |   |                    |  | | |           | |           *****         |   | | |||||     |   ||  | |  |       |  |  |            || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                     |  | || || |                  || ||     |  *****     |  ||  |      |  |  |  |   | |   |                    |  | | |           | |           || ||         |   | | |||||     |   ||  | |  |       |  |  |            || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..                     |  ***| || |                  || ||     |  |         |  ||  |      |  |  |  |   | |   |                    |  | | |           | |           || ||         |   | | |||||     |   ||  | |  |       |  |  |            || || |  |        |  |        | |                 || ||||  |  | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     |  |  | || |                  ****|     ****         |  ||  |      **********   | |   |                    |  | | |           | |           ****|         |   | ****|||     |   ||  | ****       |  |  |            **********        ****        | |                 |****||  **** |      
search RasMol script viewer Motif-ligand binding stats  nest ..                     |  |  ***| |                   |  |     |  |         |  ||  |         |  |  |   | |   |                    |  | | |           | |            |  |         |   |   *****     |   ||  |            |  |  |                  |  |        |  |        ***                 |  ****     | |      
search RasMol script viewer Motif-ligand binding stats  niche ..                     ****     ***                   ****     ****         |  ||  |         *******   | |   |                    **** ***           ***            ****         |   |             |   |****            *******                  ****        ****                            |    |      ***      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                          |  ||  |               |   | |   |                                                                   |   |             |   |                                                                                     ******               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                          |  ||  |               ***** |   |                                                                   |   |             |   |                                                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                          ********                     *****                                                                   *****             *****                                                                                                          

   New search    3bun:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors