triangle PDBeMotif: 2zpx  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification cytokine    | release date: Tue, Jul 29, 2008
Title tnf receptor subtype one-selective tnf mutant with antagonistic activity; r1anttnf-t8
Authors T.NAKAMURA, Y.MUKAI, Y.TSUTSUMI, Y.YAMAGATA
Method X-RAY DIFFRACTION (resolution: 2.83Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
VRSSSRTPSDMPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFSGQGCPSTHVLLTHTI
SRITPAINRPVNLLSAIRSPCQRETPEGAEANPWYEPIYLGGVFQLEPGDRLSAEINRPDYLDFAESGQVYFGIIAL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TUMOR NECROSIS FACTOR
member of: CATH:search2.60.120.40GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  .......eeeee..................eee...ee....ee....eeeeeeeeeeeeee........eeeeeeee......eeeeeeeee........eeeeeeeeeeeeee....eeeeee..............eeeeee.
sequence :  ..PSDMPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFSGQGCPSTHVLLTHTISRITPAINRPVNLLSAIRSPCQ..ANPWYEPIYLGGVFQLEPGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..8         18        28        38        48        58        68        78        88        98   ..111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |         | |||     | |               |               |   |    |                   ||        ..                |  |        |  |   | |||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***         | |||     | |               |               |   |    |                   ||        ..                |  |        |  |   | |||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | |||     | |               |               |   ^*****                   ||        ..                |  |        |  |   | |||       
search RasMol script viewer Motif-ligand binding stats  TNF_1 ..            | |||     | |               *****************                            ||        ..                |  |        |  |   | |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | |||     | |                                                            **        ..                |  |        |  |   | |||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |||     | |                                                                      ..                ****        |  |   ****|       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            | ***     ***                                                                      ..                |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |                                                                               ..                |  |        |  |     ***       
search RasMol script viewer Motif-ligand binding stats  niche ..            ****                                                                               ..                ****        ****               

chain B : TUMOR NECROSIS FACTOR
member of: CATH:search2.60.120.40GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  .......eeeee..................eee...ee....ee....eeeeeeeeeeeeee........eeeeee..........eeeeeee........eeeeeeeeeeeeee....eeeeee..............eeeeee.
sequence :  ..PSDMPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFSGQGCPSTHVLLTHTISRITPAINRPVNLLSAIRSPCQ..ANPWYEPIYLGGVFQLEPGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..8         18        28        38        48        58        68        78        88        98   ..111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |           | |    | |                |               |   |    |                         | | ..                |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***           | |    | |                |               |   |    |                         | | ..                |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              | |    | |                |               |   ^*****                         | | ..                |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  TNF_1 ..              | |    | |                *****************                                  | | ..                |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |    | |                                                                   | | ..                ****        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              ***    | |                                                                   | | ..                |  |        |  ||  | | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                     | |                                                                   | | ..                |  |        |  ||  | ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                     ***                                                                   *** ..                ****        ********           

chain C : TUMOR NECROSIS FACTOR
member of: CATH:search2.60.120.40GENE3D:searchG3DSA_2.60.120.40PANTHER:searchPTHR11471/searchPTHR11471_SF7PFAM:searchPF00229PRINTS:searchTNECROSISFCT/searchTNFALPHAPROSITE PATTERNS:searchPS00251, PROSITE PROFILES:searchPS50049, SMART:searchSM00207SUPERFAMILY:searchSSF49842UniProt:searchP01375
sec str:  .......eeeee..................eee...ee....ee....eeeeeeeeeeeeee........eeeeeeee.......eeeeeeee........eeeeeeeeeeeeee....eeeeee.....ee.......eeeeee.
sequence :  ..PSDMPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFSGQGCPSTHVLLTHTISRITPAINRPVNLLSAIRSPCQ..ANPWYEPIYLGGVFQLEPGDRLSAEINRPDYLDFAESGQVYFGIIAL
seq num:  ..8         18        28        38        48        58        68        78        88        98   ..111       121       131       141       151    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |           | |                       |               |   |    |                   ||        ..                |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***           | |                       |               |   |    |                   ||        ..                |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              | |                       |               |   ^*****                   ||        ..                |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  TNF_1 ..              | |                       *****************                            ||        ..                |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | |                                                                    **        ..                |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | |                                                                              ..                ****        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              ***                                                                              ..                |  |        |  |     | |       
search RasMol script viewer Motif-ligand binding stats  nest ..                                                                                               ..                |  |        |  |     ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                               ..                ****        ****               

   New search    2zpx:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors