triangle PDBeMotif: 2zi0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification gene regulation/rna    | release date: Tue, Feb 12, 2008
Title crystal structure of tav2b/sirna complex
Authors H.-Y.CHEN, Y.A.YUAN
Method X-RAY DIFFRACTION (resolution: 2.82Å)
PDBe Citation   
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MASIEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELSAINSDNSSDEGHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN 2B
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..EIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELSAINSDN
seq num:  ..5         15        25        35        45        55        
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                             | ||| |  |   |                ^
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                             | ||| ^***   |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                             ****|    |   |                 
search RasMol script viewer Motif-ligand binding stats  nest ..                               ***    |   |                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                      *****                 

chain B : PROTEIN 2B
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh
sequence :  ..IEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELS
seq num:  ..4         14        24        34        44        54   
search RasMol script viewer Motif-ligand binding stats  PS00001 ..| |                          || ||| |  ||              
search RasMol script viewer Motif-ligand binding stats  PS00006 ..| |                          || ||| ^***|              
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |                          |****| |   |              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***                          |  | | |   |              
search RasMol script viewer Motif-ligand binding stats  nest ..                             |  *** |   |              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                             ****** |   |              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                    *****              

chain C : RNA (5'-D(P*AP*GP*AP*CP*AP*GP*CP*AP*UP*UP*AP*UP*GP*CP*UP*GP*UP*CP*U3');
sec str:  ......................
sequence :  ..AGACAGCAUUAUGCUGUCUU
seq num:  ..1         11        

chain D : RNA (5'-D(P*AP*GP*AP*CP*AP*GP*CP*AP*UP*UP*AP*UP*GP*CP*UP*GP*UP*CP*U3');
sec str:  ......................
sequence :  ..AGACAGCAUUAUGCUGUCUU
seq num:  ..1         11        

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN 2B
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..EIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELSAINSDN
seq num:  ..5         15        25        35        45        55        
search RasMol script viewer Motif-ligand binding stats  PS00001 ..                             | ||| |  |   |                ^
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                             | ||| ^***   |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                             ****|    |   |                 
search RasMol script viewer Motif-ligand binding stats  nest ..                               ***    |   |                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                      *****                 

chain B : PROTEIN 2B
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh
sequence :  ..IEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHARQVELS
seq num:  ..4         14        24        34        44        54   
search RasMol script viewer Motif-ligand binding stats  PS00001 ..| |                          || ||| |  ||              
search RasMol script viewer Motif-ligand binding stats  PS00006 ..| |                          || ||| ^***|              
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |                          |****| |   |              
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***                          |  | | |   |              
search RasMol script viewer Motif-ligand binding stats  nest ..                             |  *** |   |              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                             ****** |   |              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                    *****              

chain C : RNA (5'-D(P*AP*GP*AP*CP*AP*GP*CP*AP*UP*UP*AP*UP*GP*CP*UP*GP*UP*CP*U3');
sec str:  ......................
sequence :  ..AGACAGCAUUAUGCUGUCUU
seq num:  ..1         11        

chain D : RNA (5'-D(P*AP*GP*AP*CP*AP*GP*CP*AP*UP*UP*AP*UP*GP*CP*UP*GP*UP*CP*U3');
sec str:  ......................
sequence :  ..AGACAGCAUUAUGCUGUCUU
seq num:  ..1         11        

   New search    2zi0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors