triangle PDBeMotif: 2toh  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.14.16.2
Classification hydroxylase    | release date: Wed, Aug 26, 1998
Title tyrosine hydroxylase catalytic and tetramerization domains f
Authors C.SABATIER, K.E.GOODWILL, R.C.STEVENS
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search FE FE binding statistics FE   search HBI HBI binding statistics HBI   search CL CL binding statistics CL
Modified residues:  search MTY MTY binding statistics MTY
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VRSAREDKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYKHGEPIPHVEYTAEEIATWKE
VYVTLKGLYATHACREHLEGFQLLERYCGYREDSIPQLEDVSRFLKERTGFQLRPVAGLLSARDYLASLAFRVFQCTQYI
RHASSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTVYWFTVEFGLCKQNGELKAYGAGLLS
SYGELLHSLSEEPEVRAFDPDTAAVQPYQDQTYQPVYFVSESFNDAKDKLRNYASRIQRPFSVKFDPYTLAIDVLDSPHT
IQRSLEGVQDELHTLAHALSAIS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TYROSINE 3-MONOOXYGENASE
member of: CATH:search1.10.800.10GENE3D:searchG3DSA_1.10.800.10PANTHER:searchPTHR11473PFAM:searchPF00351PIRSF:searchPIRSF000336PRINTS:searchFYWHYDRXLASEPROSITE PATTERNS:searchPS00367, PROSITE PROFILES:searchPS51410, SUPERFAMILY:searchSSF55021/searchSSF56534TIGRFAMS:searchTIGR01269UniProt:searchP04177
JMol viewer RasMol script viewer  HBI 500A  ..                       ..                                                                                                         *  **    *         *                *    *                                      *    *                                                                                                                          
JMol viewer RasMol script viewer  CL 510A  ..                       ..                                                                                                         |  ||    |         |                |    |                                      |    |                                                             **                                                           
JMol viewer RasMol script viewer  FE 501A  ..                       ..                                                                                                         |  ||    |         |                |   *|   *                                  |    *                                                             ||                                                           
sec str:  .............hhhhhh....................hhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..........hhhhhhhhhhh...eeee.......hhhhh.hhh.eeee......hhh........hhhhhhh.hhhhh.hhhhhhhhhhhhhh....hhhhhhhhhhhh......eeee..eeee..hhhh..hhhhhhhh....eeee..hhhhhh..........eeee...hhhhhhhhhhhhh......eeeee....eeeee..hhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..REDKVPWFPRKVSELDKCHHLVT..PDLDLDHPGFSDQVYRQRRKLIAEIAFQYKHGEPIPHVEYTAEEIATWKEVYVTLKGLYATHACREHLEGFQLLERYCGYREDSIPQLEDVSRFLKERTGFQLRPVAGLLSARDYLASLAFRVFQCTQYIRHASSPMHSPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTVYWFTVEFGLCKQNGELKAYGAGLLSSYGELLHSLSEEPEVRAFDPDTAAVQPYQDQTYQPVYFVSESFNDAKDKLRNYASRIQRPFSVKFDPYTLAIDVLDSPHTIQRSLEGVQDELHTLAHALSAIS
seq num:  ..160       170          ..186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..||       **^*||| |    |..   |  |              || ||| ||  |       | ||||| ||   ||||||| ||                 |  |          |  || |      |  | |||  || |||   | |     |  |   |   |    | ||  |   |      || || ||  |||   |||  ||  || ||  |   ||||||||| || || |||      | | |  |   | |         |  ||       |  |    | | | || |                                
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*|        | |||| |    |..   |  |              || ||| ||  |       | ||||^**|   ^**|||| ||                 |  |          |  || |      |  ^**||  || |||   | |     |  |   |   |    | ||  |   |      || || ||  |||   |||  ||  || ||  |   ||||||||| || || |||      | | |  |   | |         |  ||       |  |    ^** | || |                                
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**        | ^*** |    ^..   |  |              || ||| ||  |       ^***||^***   || |||| ||                 |  |          |  || |      |  ^***|  || |||   | |     |  |   |   |    | ||  |   |      || || |^***||   |||  ||  || ||  |   |||||||^***| |^***|      | | |  |   | |         ^***|       |  |        | || |                                
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          |  ||  |     ..   |  |              || ||| ||  |       | | |||  |   || |||| ||                 |  |          |  || |      |  | | |  || |||   | |     |  |   |   |    | ||  |   |      || || ||  |||   |||  ||  || ********^||||||||  | |  | |      | | |  |   | |         |   |       |  |        | || |                                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  ||  |     ..   |  |              || ||| ||  |       | | |||  |   || ^*****|                 |  |          |  || |      ^***** |  || |||   | |     |  |   |   |    | ||  |   |      || || ||  |||   |||  ||  ||  |  |    ||^*****  | |  | |      | | |  |   | |         |   |       |  |        | || |                                
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..          |  ||  |     ..   |  |              || ||| ||  |       | | |||  |   ||  |||  |                 |  |          |  || |         |   |  || |||   | |     |  |   |   |    | ||  |   |      || || ||  |||   |||  ||  |********************** |  | |      | | |  |   | |         |   |       |  |        | || |                                
search RasMol script viewer Motif-ligand binding stats  BH4_AAA_HYDROXYL_1 ..          |  ||  |     ..   |  |              || ||| ||  |       | | |||  |   ||  |||  |                 |  |          |  || |         |   |  || |||   | |     |  |   ****^****^**|  |   |      || || ||  |||   |||  ||  |   |  |    || ||||     |  | |      | | |  |   | |         |   |       |  |        | || |                                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          |  ||  |     ..   |  |              |***** ||  |       | *****  |   |*****|  |                 |  |          ***** |         |   |  || |||   | |     |  |               |  |   |      || || |*****|   ||*****  |   |  |    *****||     |  | |      | | |  |   | |         |   |       |  |        | || |                                
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |  ||  |     ..   |  |              || ||  ||  |       | | ||   |   ||  | |  |                 |  |          |  || |         |   |  || |||   | |     |  |               |  *****      || || ||  |||   |||  ||  |   |  |    || | ||     |  | |      | | |  |   | |         |   |       |  |        | || |                                
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  ||  |     ..   |  |              || ||  ||  |       | | ||   |   ||  | |  |                 |  |          |  || |         |   |  || |||   | |     |  |               |  |          || || ||  |||   |||  ||  |   |  |    || | ||     |  | |      *** |  |   | |         |   |       |  |        ***| |                                
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ********     ..   |  |              ********|  |       | ****   |   |**** |  |                 |  |          ****| |         |   |  *****|   | |     |  |               |  |          ***********||   ||****|  |   ****    **** ||     **** |          ****   | |         |   |       |  |           | |                                
search RasMol script viewer Motif-ligand binding stats  nest ..                       ..   |  |                  |  ||  |       |   |    |   |     |  |                 |  |              ***         |   |     ***   | |     |  |               |  |           | || ||   ||   ||   ||  |            | | ||        | |          |  |   | |         |   |       |  |           ***                                
search RasMol script viewer Motif-ligand binding stats  niche ..                       ..   ****                  ********       |   |    |   |     ****                 ****                          |   |           ***     ****               ****           ******|   ||   ||   |****            | ****        | |          ****   ***         |   |       ****                                              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                       ..                                        *****    |   |                                                        *****                                                           *****|   ||   |                |   |         | |                             *****                                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       ..                                                 *****                                                                                                                             **********                *****         | |                                                                                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ..                                                                                                                                                                                                                           ***                                                                                           

   New search    2toh:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors