triangle PDBeMotif: 2q7m  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification membrane protein, lipid transport    | release date: Thu, Jun 7, 2007
Title crystal structure of human flap with mk-591
Authors A.D.FERGUSON
Method X-RAY DIFFRACTION (resolution: 4.25Å)
PDBe Citation   
Small molecules:    search 2CS 2CS binding statistics 2CS
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F sequence:
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQ
VPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIATISTTISPLLLI
P
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ARACHIDONATE 5-LIPOXYGENASE-ACTIVATING PROTEIN
JMol viewer RasMol script viewer  2CS 503A  ..                                                             **                                                **  *  **  *                
JMol viewer RasMol script viewer  2CS 502A  ..                    * *** **                                 ||                                                ||  |  ||  |                
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFF
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                 |  ||  |  ||||| |  |        |    |   | |  |||   |     |  ||   |    |  ||  ||          | | |  | ||| |   || |||    |  ||    
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                 |  ||  |  ||||| |  |        |    |   | |  |||   |     |  ^*****    |  ||  ||          | | |  | ||| |   || |||    |  ||    
search RasMol script viewer Motif-ligand binding stats  PS00009 ..                 |  ||  |  ||||| |  |        |    |   | |  |||   |     |  ||        |  ||  ||          | | |  | |^***   || |||    |  ||    
search RasMol script viewer Motif-ligand binding stats  PS01297 ..                 |  ||  |  ||||| |  |        ***************||   |     |  ||        |  ||  ||          | | |  | | | |   || |||    |  ||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 *****  ******** |  |             |   | *****|   |     *****        *********          | | |  | | | |   *****|    *****    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 ****   *******  |  |             |   | **** |   |     ****         ********           | | |  | | | |   **** |    ****     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             |   |  |             |   |      |   |                                     *****  | | | |    |   |             
search RasMol script viewer Motif-ligand binding stats  nest ..                             |   |  |             |   |      |   |                                            | | ***    |   |             
search RasMol script viewer Motif-ligand binding stats  niche ..                             |   ****             |   |      |   |                                            ***        |   |             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                             *****                *****      *****                                                       *****             

chain B : ARACHIDONATE 5-LIPOXYGENASE-ACTIVATING PROTEIN
JMol viewer RasMol script viewer  2CS 503A  ..                    * *** **                                *                                                                                       
JMol viewer RasMol script viewer  2CS 501C  ..                    | ||| ||                                |**                                                    *  **  *                         
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141     
search RasMol script viewer Motif-ligand binding stats  PS00006 ..              |  || ||  |  || ||             |          |  |||   |     |  ||   |    |  || |||         | | | | | || ||   |  ||  |  || ||  |  ^***| | 
search RasMol script viewer Motif-ligand binding stats  PS00008 ..              |  || ||  |  || ||             |          |  |||   |     |  ^*****    |  || |||         | | | | | || ||   |  ||  |  || ||  |  |   | | 
search RasMol script viewer Motif-ligand binding stats  PS00009 ..              |  || ||  |  || ||             |          |  |||   |     |  ||        |  || |||         | | | | | |^***   |  ||  |  || ||  |  |   | | 
search RasMol script viewer Motif-ligand binding stats  PS01297 ..              |  || ||  |  || ||             ***************||   |     |  ||        |  || |||         | | | | | || |    |  ||  |  || ||  |  |   | | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              |  *****  ********                        *****|   |     *****        *********         | | | | | || |    *****  ********  |  |   | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |  ****   *******                         **** |   |     ****         ********          | | | | | || |    ****   *******   ****   | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              |   |                                          |   |                                    | | ***** |***                            *** 
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |                                          |   |                                    ***     ***                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                          *****                                                                                  

chain C : ARACHIDONATE 5-LIPOXYGENASE-ACTIVATING PROTEIN
JMol viewer RasMol script viewer  2CS 502A  ..                                                             **                                                 *  *  **  *                          
JMol viewer RasMol script viewer  2CS 501C  ..                    * *** *                                 *||                                                 |  |  ||  |                          
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhh..........
sequence :  ..MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIAT
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                 |  ||  |  || ||             |          |  ||          |  ||   |    |  || |||          | | | |   || |   || |||    |  ||  || ^***|    
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                 |  ||  |  || ||             |          |  ||          |  ^*****    |  || |||          | | | |   || |   || |||    |  ||  ||  || |    
search RasMol script viewer Motif-ligand binding stats  PS00009 ..                 |  ||  |  || ||             |          |  ||          |  ||        |  || |||          | | | |   ^***   || |||    |  ||  ||  || |    
search RasMol script viewer Motif-ligand binding stats  PS01297 ..                 |  ||  |  || ||             ***************|          |  ||        |  || |||          | | | |    | |   || |||    |  ||  ||  || |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 *****  ********                        *****          *****        *********          | | | |    | |   *****|    *********  || |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 ****   *******                         ****           ****         ********           | | | |    | |   **** |    ************| |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                                                                                       | *** |    | |    |   |            |  |***    
search RasMol script viewer Motif-ligand binding stats  nest ..                                                                                                       *** | |    ***    |   |            |  |       
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                                           ***           |   |            ****       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                         *****                       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : ARACHIDONATE 5-LIPOXYGENASE-ACTIVATING PROTEIN
JMol viewer RasMol script viewer  2CS 505E  ..                                                             **                                                    *  **  *                        
JMol viewer RasMol script viewer  2CS 504D  ..                    * *** **                            *   *||                                                    |  ||  |                        
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYI
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141    
search RasMol script viewer Motif-ligand binding stats  PS00006 ..              |  || ||  |  || ||  |  |    | ||          |  |||   |  |  || ||   |    |  ||  ||        | | | |     |  |   || |||    |  ||  || ^***| |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..              |  || ||  |  || ||  |  |    | ||          |  |||   |  |  || ^*****    |  ||  ||        | | | |     |  |   || |||    |  ||  ||  | || |
search RasMol script viewer Motif-ligand binding stats  PS00009 ..              |  || ||  |  || ||  |  |    | ||          |  |||   |  |  || ||        |  ||  ||        | | | |     ^***   || |||    |  ||  ||  | || |
search RasMol script viewer Motif-ligand binding stats  PS01297 ..              |  || ||  |  || ||  |  |    | |***************||   |  |  || ||        |  ||  ||        | | | |            || |||    |  ||  ||  | || |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              |  *****  ********  |  |    | |           *****|   |  |  *****        *********        | | | |            *****|    *********  | || |
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |  ****   *******   ****    | |           **** |   |  |  ****         ********         | | | |            **** |    ********   | || |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              |   |                       | |                |   |  |   |                            *** | |             |   |               | |***
search RasMol script viewer Motif-ligand binding stats  nest ..              |   |                       | |                |   |  |   |                                ***             |   |               ***   
search RasMol script viewer Motif-ligand binding stats  niche ..              |   |                       ***                |   |  |   |                                                |   |                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..              *****                                          *****  *****                                                *****                     

chain E : ARACHIDONATE 5-LIPOXYGENASE-ACTIVATING PROTEIN
JMol viewer RasMol script viewer  2CS 506E  ..                                                             **                                                 *  *  **  *                 
JMol viewer RasMol script viewer  2CS 505E  ..                    * *** **                                *||                                                 |  |  ||  |                 
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                 |  ||  |  || ||   |||||| | ||    |   | |  ||       |  || ||   |    |  ||  ||           | |      |  |   || |||    |  ||     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                 |  ||  |  || ||   |||||| | ||    |   | |  ||       |  || ^*****    |  ||  ||           | |      |  |   || |||    |  ||     
search RasMol script viewer Motif-ligand binding stats  PS00009 ..                 |  ||  |  || ||   |||||| | ||    |   | |  ||       |  || ||        |  ||  ||           | |      ^***   || |||    |  ||     
search RasMol script viewer Motif-ligand binding stats  PS01297 ..                 |  ||  |  || ||   |||||| | |***************|       |  || ||        |  ||  ||           | |             || |||    |  ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 *****  ********   |||||| | |     |   | *****       |  *****        *********           | |             *****|    *****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 ****   *******|   |||||| | |     |   | ****        |  ****         ********            | |             **** |    ****      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                               |   |||*** ***     |   |             |   |                               ***              |   |              
search RasMol script viewer Motif-ligand binding stats  nest ..                               |   |****          |   |             |   |                                                |   |              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****              *****             *****                                                *****              

chain F : ARACHIDONATE 5-LIPOXYGENASE-ACTIVATING PROTEIN
JMol viewer RasMol script viewer  2CS 506E  ..                    * *** *                                                                                                                          
JMol viewer RasMol script viewer  2CS 504D  ..                    | ||| |                                  **                                                    *  **  *                          
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhh..........
sequence :  ..MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIAT
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141      
search RasMol script viewer Motif-ligand binding stats  PS00006 ..                 |  ||  |  || ||       | |   |          |  ||          |  ||   |    |  ||  ||          | |       || |   |  ||     |  ||     ^***     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                 |  ||  |  || ||       | |   |          |  ||          |  ^*****    |  ||  ||          | |       || |   |  ||     |  ||              
search RasMol script viewer Motif-ligand binding stats  PS00009 ..                 |  ||  |  || ||       | |   |          |  ||          |  ||        |  ||  ||          | |       ^***   |  ||     |  ||              
search RasMol script viewer Motif-ligand binding stats  PS01297 ..                 |  ||  |  || ||       | |   ***************|          |  ||        |  ||  ||          | |        | |   |  ||     |  ||              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 *****  ********       | |              *****          *****        *********          | |        | |   *****     *****              
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 ****   *******        | |              ****           ****         ********           | |        | |   ****      ****               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                       ***                                                             | |        | |                                
search RasMol script viewer Motif-ligand binding stats  nest ..                                                                                                       ***        ***                                

   New search    2q7m:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors