triangle PDBeMotif: 2phk  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.38
Classification complex (transferase/peptide)    | release date: Thu, Jun 18, 1998
Title the crystal structure of a phosphorylase kinase peptide subs complex: kinase substrate recognition
Authors D.J.OWEN, E.D.LOWE, L.N.JOHNSON, M.E.M.NOBLE, N.G.OIKONOMAKOS, V.T.SKAMNAKI
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Small molecules:    search MN MN binding statistics MN   search ATP ATP binding statistics ATP   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GFYENYEPKEILGRGVSSVVRRCIHKPTCKEYAVKIIDVTGGGSFSAEEVQELREATLKEVDILRKVSGHPNIIQLKDTY
ETNTFFFLVFDLMKKGELFDYLTEKVTLSEKETRKIMRALLEVICALHKLNIVHRDLKPENILLDDDMNIKLTDFGFSCQ
LDPGEKLREVCGTPSYLAPEIIECSMNDNHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFGSPEW
DDYSDTVKDLVSRFLVVQPQKRYTAEEALAHPFFQQY
Chain B sequence:
RQMSFRL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PHOSPHORYLASE KINASE
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24347/searchPTHR24347_SF120PFAM:searchPF00069PRINTS:searchPHOSPHBKNASEPROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchP00518
JMol viewer RasMol script viewer  GOL 384A  ..                                                                                                                                                                                                                                                                    **    *          
JMol viewer RasMol script viewer  ATP 381A  ..            * *  * *            * *                                                       * *   *                                        * ** *          *                                                                                                          ||    |          
JMol viewer RasMol script viewer  MN 383A  ..            | |  | |            | |                                                       | |   |                                        | || |          |                                                                                                          ||    |          
JMol viewer RasMol script viewer  MN 382A  ..            | |  | |            | |                                                       | |   |                                        | || |          |                                                                                                          ||    |          
sec str:  .......eee..eeee...eeeeeeee.....eeeeeeee........hhhhhhhhhhhhhhhhhhhh.........eeeeee...eeeeeee......hhhhhhhh....hhhhhhhhhhhhhhhhhhhhh........hhheee.....eee.....................hhh..hhhhhh..........hhhhhhhhhhhhhhhhh.........hhhhhhhhhh........hhhh..hhhhhhhhhh....hhh...hhhhhh.......
sequence :  ..GFYENYEPKEILGRGVSSVVRRCIHKPTCKEYAVKIIDVTGGGSFSAEEVQELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKKGELFDYLTEKVTLSEKETRKIMRALLEVICALHKLNIVHRDLKPENILLDDDMNIKLTDFGFSCQLDPGEKLREVCGTPSYLAPEIIECSMNDNHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQKRYTAEEALAHPFFQQY
seq num:  ..14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  |     || |  |         | ||   |  | | |   || ||      | ||    **^* |  |   ||   |  |        |      | | | | ||| | |              | | | | || || |  | |    ||| |   |  | | |   ||  |      || || |      |   |         | |    | |         | |       |  |  | ||  |   | || **^*  ||  |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |     || |  |         ^**|   |  | | |   || ||      ^**|    | || |  |   ||   |  |        |      | ^** | ^** ^**              | | | | || || |  | |    ||| |   |  | | |   ||  |      || || |      |   |         | |    | |         | |       |  |  ^**|  |   | ||  | |  ||  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |     || |  |         ^***   |  | | |   ^***|      ^***    | || |  |   ||   |  |        |      |   | ^***  |                | | | | || || |  | |    ||| |   |  | | |   ||  |      |^*** |      |   |         | |    | |         | |       |  |  ^***  |   | ||  | ^***|  |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |     || |  |         | |    |  | | |   ||  |              | || |  |   ||   |  |        *******^   | | |   |                | | | | || || |  | |    ||| |   |  | | |   ||  |      |  |  |      |   |         | |    | |         | |       |  |    |   |   | ||  | |   |  |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |     || |  |         | |    |  | | ^*****  |              | || |  |   ||   |  |                   | | |   |                | | | | || || |  | |    ||| |   |  | | |   ||  |      |  |  |      |   |         | |    | |         | |       |  |    |   |   | ||  | |   |  |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..  |  |     ************************  | | |   |   |              | || |  |   ||   |  |                   | | |   |                | | | | || || |  | |    ||| |   |  | | |   ||  |      |  |  |      |   |         | |    | |         | |       |  |    |   |   | ||  | |   |  |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..  |  |     || |  |         | |       | | |   |   |              | || |  |   ||   |  |                   | | |   |                | ****^********  | |    ||| |   |  | | |   ||  |      |  |  |      |   |         | |    | |         | |       |  |    |   |   | ||  | |   |  |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |     || |  |         | |       *** |   |   |              | || |  |   ||   |  |                   | | |   |                | | | | || ||    | |    *** |   |  | | |   ||  |      |  |  |      |   |         | |    | |         | |       |  |    |   |   | ||  | |   |  |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  |     ** |  |         | |         | |   |   |              | || |  |   **   |  |                   | | |   |                | | | | || ||    | |    ||| |   |  | | |   ||  |      |  |  |      |   |         | |    | |         | |       |  |    |   |   | ||  | |   |  |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |        |  |         | |         | |   |   |              | || |  |        |  |                   *** |   |                | | | | || ||    | |    ||| |   |  | | |   ||  |      |  |  |      |   |         | |    | |         | |       |  |    |   |   | ||  | |   |  |      
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |        |  |         ***         ***   |   |              | || |  |        |  |                       |   |                *** *** || ||    ***    *** |   |  | | |   ||  |      |  |  |      |   |         ***    | |         ***       |  |    |   |   | ||  | |   |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..  ****        ****         | |               |   |              *********        ****                       |   |                      | |****            ****   **** ***   |****      *******      |   |                ***                   ****    |   |   ******* |   ****      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                           | |               *****                                                          |   |                      | |  |                               |                       |   |                                              |   |           *****         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                           | |                                                                              *****                      | |  |                               |                       *****                                              *****                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                           ***                                                                                                         | |  |                               |                                                                                                        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                       * *  *                               *                                                                                                        

chain B : MC-PEPTIDE
JMol viewer RasMol script viewer  ATP 381A  ..   *   
JMol viewer RasMol script viewer  MN 382A  ..   |   
sec str:  .........
sequence :  ..RQMSFRL
seq num:  ..2      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^** 

   New search    2phk:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML