triangle PDBeMotif: 2oq1  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.10.2
Classification transferase    | release date: Tue, Jan 30, 2007
Title tandem sh2 domains of zap-70 with 19-mer zeta1 peptide
Authors E.R.LAIRD, J.GREEN, J.MORGENSTERN, M.H.HATADA, M.K.RAM
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search PB PB binding statistics PB
Modified residues:  search PTR PTR binding statistics PTR search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
DPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAE
LCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMP
WYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLK
ADGLIYCLKEACPN
Chain B sequence:
NQLYNELNLGRREEYDVLD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TYROSINE-PROTEIN KINASE ZAP-70
member of: CATH:search1.10.930.10/search3.30.505.10GENE3D:searchG3DSA_1.10.930.10/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF80PFAM:searchPF00017PIRSF:searchPIRSF000604PRINTS:searchSH2DOMAINPROSITE PROFILES:searchPS50001, SMART:searchSM00252SUPERFAMILY:searchSSF55550UniProt:searchP43403
JMol viewer RasMol script viewer  PB 1119A  ..                                                                                                                  *                                                                                                                                           
sec str:  ...............hhhhhhhhhhhh......eeeee.......eeeeeee..eeeeeeeee.....eee.......hhhhhhhhhhhh......................hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh......eeeeee.....eeeeeeee..eeeeeeeee.....ee........hhhhhhhhhhhh..............
sequence :  ..DPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPN
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| ||||  |    |  |       ||||  |     |  |  |      |  |          ^*** |  |         |   |  | ||   |      || ||   |    |       |   |||||  |             |   || || |  |    || ||    |  | |  |   | | |  ||                 | |||  |  ||  |       |||||| || | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| ||||  |    |  |       ||||  |     |  |  |      |  |          | |  |  |         |   |  | ||   |      || ||   |    |       |   ^**||  |             |   || || |  |    || ||    |  | |  |   | | |  ||                 | |||  |  ||  |       |||||| || | |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| ||||  |    ^***       ||||  |     |  |  |      |  |          | |  |  |         |   |  | ||   |      |^***   |    |       |   || ||  |             |   |^*** |  |    ^***|    |  | |  |   | | |  ||                 | |||  |  |^***       |||||| || | |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| ||||  |               ||||  |     |  |  |      |  |          | |  |  |         |   |  | ||   |      |  |    |    |       |   || ||  |             |   |  |  |  |    |********^  | |  |   ********^                 | |||  |  |           ||********^ |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ||||  |               |^*****     |  |  |      |  |          | |  |  |         |   |  | ^*****      |  |    ^*****       |   || ||  |             |   |  |  |  |    |   |       | |  |     | |  |                  | |||  |  |           || ||| ^*****      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| ||||  |               | ||  |     |  |  |      |  |          | |  |  |         |   |  |  |          |  |                 |   || ||  |             |   |  |  |  |    |   |       | |  |     | |  |                  | |||  |  |           *****| ||          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..*****|  |               | ||  |     |  |  |      |  |          | |  |  |         |   |  |  |          |  |                 |   || ||  |             |   |  |  |  |    |   |       | |  |     | |  |                  | |||  |  |           || ||| ||          
search RasMol script viewer Motif-ligand binding stats  asxturn ..***| |  |               | ||  |     |  |  |      |  |          | |  |  |         |   |  |  |          |  |                 |   || ||  |             |   |  |  |  |    |   |       | |  |     | |  |                  | |||  |  |           || ||| ||          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..| || |  |               | ||  |     |  |  |      |  |          | |  |  |         |   |  |  |          |  |                 |   || ||  |             |   |  |  |  |    |   |       | |  |     | |  |                  *****  |  |           || ||| ||          
search RasMol script viewer Motif-ligand binding stats  betaturn ..**** |  |               | ||  |     |  |  |      ****          | |  ****         |   |  ****          ****                 |   || |****             |   |  ****  |    |   |       | ****     | ****                  ****|  ****           ****|****          
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |  |               ***|  |     |  |  |                    ***  |  |         |   |                |  |                 |   |***                 |   |  |  |  |    |   |       ***  |     | |  |                    ***                  |  |***           
search RasMol script viewer Motif-ligand binding stats  niche ..  *******                  ****     *******                         ****         |   |                ****                 |   |                    |   |  *******    |   |         ****     ******                                         ****              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                 |   |                                     |   |                    |   |             *****                                                                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                 *****                                     *****                    *****                                                                                                     

chain B : T-CELL SURFACE GLYCOPROTEIN CD3 ZETA CHAIN
member of: PANTHER:searchPTHR10035PFAM:searchPF02189PROSITE PROFILES:searchPS51055, SMART:searchSM00077UniProt:searchP20963
sec str:  .........hhhhh.......
sequence :  ..NQLYNELNLGRREEYDVLD
seq num:  ..301       311      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       |^***       
search RasMol script viewer Motif-ligand binding stats  asxturn ..       *** |       
search RasMol script viewer Motif-ligand binding stats  niche ..        ****       

   New search    2oq1:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML