triangle PDBeMotif: 2og8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.10.2
Classification transferase    | release date: Fri, Jan 5, 2007
Title crystal structure of aminoquinazoline 36 bound to lck
Authors X.HUANG
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search 1N8 1N8 binding statistics 1N8
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
DEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYII
TEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYT
AREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRL
CWKERPEDRPTFDYLRSVLEDFFTA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF204PFAM:searchPF07714PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF55550/searchSSF56112UniProt:searchP06239
JMol viewer RasMol script viewer  1N8 501A  ..                      *           * *              *   *  *    **              ****  *                                     *          *         ***  ..                                                                                                 
sec str:  ......hhh.eeeeeeeeee..eeeeeeee...eeeeeeee.....hhhhhhhhhhhhhhh.......eeeee.....eeeee.....hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee............hhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhh...........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhh...
sequence :  ..EWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGL..PIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFT
seq num:  ..237       247       257       267       277       287       297       307       317       327       337       347       357       367       377      ..403       413       423       433       443       453       463       473       483       493    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | ||| || |              | |    || | | ||   |           |  |                    ^*** ||  |  || |||  |                | | | | || || || | | |      .. |  |  |   | | | |||  | |   ||  | |   |  ||  |   || |||                || ||  |  | |   | |  ||  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | ^** || |              | |    |^** | ||   |           |  |                      |  ||  |  || |||  |                | | | | || || || | ^**      .. |  |  |   | | ^**||  | |   ||  | |   |  ||  |   || |||                || ||  |  | |   | |  ||  |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  |  || |              | |    |    | ||   |           |  |                      ^***|  |  || |||  |                | | | | || || || | |        .. |  ^***   | | |  ||  | |   ||  | |   |  |^***   || |||                || ||  |  | |   | ^***|  |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |  |  || |              | |    |    | ||   |           |  |                          |  |  || |||  |                | | | | || || || | |        .. |  |      | | |  ||  | |   ||  | |   |  |       || |||                || ||  |  | |   |     |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |  || |              | |    |    | ||   |           |  |                          |  |  ^*****  |                | | | | || || || | |        .. |  |      | | |  ||  | ^*****  | |   |  |       || |||                || ||  |  | |   |     |  |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     |  |  || ***********************    | ||   |           |  |                          |  |  || ||   |                | | | | || || || | |        .. |  |      | | |  ||  |     |   | |   |  |       || |||                || ||  |  | |   |     |  |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..     |  |  ||                | |         | ||   |           |  |                          |  |  || ||   |                | ****^********| | |        .. |  |      | | |  ||  |     |   | |   |  |       || |||                || ||  |  | |   |     |  |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  |  ||                | |         | ||   |           |  |                          |  |  || ||   |                | | | | || ||  | | |        .. |  |      | | *****  |     |   | |   |  |       || |||                || ||  |  | |   |     |  |
search RasMol script viewer Motif-ligand binding stats  betabulge ..     |  |  **                | |         | ||   |           |  |                          |  |  || ||   |                | | | | || ||  | | |        .. |  |      | | |  ||  |     |   | |   |  |       || |||                || ||  |  | |   |     |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..     |  |                    | |         | ||   |           |  |                          ****  || ||   |                | | | | ****|  | | |        .. ****      | | ****|  |     |   | |   ****       |****|                ****|  |  | |   |     ****
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |                    ***         ***|   |           |  |                          |  |  || ||   |                *** ***  |  |  | ***        .. |  |      *** |  ||  |     |   ***   |  |       |  ***                 |  |  |  | |   |         
search RasMol script viewer Motif-ligand binding stats  niche ..     ****                                   |   |           ****                          ****  ****|   |                      |  ****  | |          .. ****          |  ||  |     |   |     ****       |    |                 ****  **** |   |         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                            |   |                                            |   |  |   |                      |        | |          ..               |  ||  |     |   |                ******                            |   |         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                            *****                                            *****  *****                      |        | |          ..               *****  |     |   |                                                  *****         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                               |        | |          ..                  *****     *****                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                               |        ***          ..                                                                                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                               *                     ..                                                                                                 

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF204PFAM:searchPF07714PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF55550/searchSSF56112UniProt:searchP06239
sec str:  .......hhh.eeeeeeeee...eeeeeeee...eeeeeeee.....hhhhhhhhhhhhhh........eeeee.....eeeee.....hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee......... .......hhhhhhh...hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhh....
sequence :  ..DEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLA... ..PIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTA
seq num:  ..236       246       256       266       276       286       296       306       316       326       336       346       356       366       376        ... ..403       413       423       433       443       453       463       473       483       493     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | |||    ||             | |    || | |||           |  | |  |                    ^*** || ||  || | |                   | | | | || || |  | | |  | |  ..PS00001.. |  || ||| | | | ||| || ||  ||| |||   |  || ||| || || |    |  ||  ||    |  |  |  | |   | |  |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | ^**    ||             | |    |^** |||           |  | |  |                      |  || ||  || | |                   | | | | || || |  | ^**  | |  ..PS00005.. |  || ||| | | ^**|| || ||  ||| |||   |  || ||| || || |    |  ||  ||    |  |  |  | |   | |  |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  |     ||             | |    |  | |||           |  | |  |                      ^***| ||  || | |                   | | | | || || |  | |    | |  ..PS00006.. |  ^***|| | | |  || || ||  ||| |||   |  |^***| || || |    |  ||  ||    |  |  |  | |   | ^***     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      |  |     ||             | |    |  | |||           |  | |  |                      |  || ||  || | |                   | | | | || || |  | |    | |  ..PS00007.. |  ||  || | | |  || || ||  ||| |||   |  || | | || || |    |  ||  ||    |  |  |  | |   |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |     ||             | |    |  | |||           |  | |  |                      |  || ||  ^*****                   | | | | || || |  | |    | |  ..PS00008.. |  ||  || | | |  || || ^*****| |||   |  || | | || || |    |  ||  ||    |  |  |  | |   |          
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..      |  |     ***********************  | |||           |  | |  |                      |  || ||  || |                     | | | | || || |  | |    | |  ..PS00107.. |  ||  || | | |  || || ||  ||| |||   |  || | | || || |    |  ||  ||    |  |  |  | |   |          
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..      |  |     ||             | |       | |||           |  | |  |                      |  || ||  || |                     | ****^********  | |    | |  ..PS00109.. |  ||  || | | |  || || ||  ||| |||   |  || | | || || |    |  ||  ||    |  |  |  | |   |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |     ||             | |       | |||           |  | |  |                      |  || ||  || |                     | | | | || ||    | |    | |  ..alphabetamotif.. |  |***** | | ***** *****  ||| |||   |  || | | ***** |    |  |*****    |  |  |  | |   |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |     ||             | |       | |||           |  | |  |                      |  || ||  || |                     | | | | || ||    | |    ***  ..asxturn.. |  ||  |  | | |  || || |   ||| |||   |  || | | || || |    |  ||  |     |  |  |  | |   |          
search RasMol script viewer Motif-ligand binding stats  betabulge ..      |  |     **             | |       | |||           |  | |  |                      |  || ||  || |                     | | | | || ||    | |         ..betabulge.. |  ||  |  | | |  || || |   ||| |||   |  || | | || || |    |  ||  |     |  |  |  | |   |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |  |                    | |       ****|           **** |  |                      |  ****|  || |                     | | | | ****|    | |         ..betaturn.. ********  | | ****| ****   ||****|   |  || | | ***** |    |  |****     |  |  |  | |   |          
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |                    ***         ***                |  |                      |   |  |  || |                     *** ***  |  |    ***         ..nest.. |  |      *** |  ||  |     ||  ***   |  || | |     ***    |  |         |  |  |  | |   |          
search RasMol script viewer Motif-ligand binding stats  niche ..      ****                                                   ****                      |   ****  ****                           |  ****                ..niche.. ****          |  ||  |     ||  | |   ****| | |            ****         ****  **** |   |          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                       |   |  |   |                             |                      ..schellmannloop..               |  ||  |     |******       | | |                                    |   |          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                       *****  *****                             |                      ..stmotif..               *****  |     |   |         *****                                    *****          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                |                      ..ststaple..                  *****     *****         | |                                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                |                      ..stturn..                                          ***                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                *                      ..REP00000..                                                                                                  

   New search    2og8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML