triangle PDBeMotif: 2ofu  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.10.2
Classification transferase    | release date: Thu, Jan 4, 2007
Title x-ray crystal structure of 2-aminopyrimidine carbamate 43 bound to lck
Authors X.HUANG
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4   search 1N9 1N9 binding statistics 1N9
Modified residues:  search PTR PTR binding statistics PTR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
PQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVT
QEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARL
IEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEE
LYQLMRLCWKERPEDRPTFDYLRSVLEDFFTAT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF204PFAM:searchPF07714PRINTS:searchTYRKINASEPROSITE PATTERNS:searchPS00107/searchPS00109, PROSITE PROFILES:searchPS50011, SMART:searchSM00219SUPERFAMILY:searchSSF55550/searchSSF56112UniProt:searchP06239
JMol viewer RasMol script viewer  1N9 1A  ..                      *       *           * *              *                         * ***** **                                             * *          *                                                                                                                       
JMol viewer RasMol script viewer  SO4 2A  ..                      |       |           | |              |                         | ||||| ||                                             | |          |                                                                          **                                           
sec str:  ..............hhh.eeeeeeeee...eeeeeeee...eeeeeeee.....hhhhhhhhhhhhhhh.......eeeee.....eeeee.....hhhhhh.hhhhhh.hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee.....ee............hhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh
sequence :  ..PQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTAT
seq num:  ..229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   || ||  |  | ||| || ||             | |    || | | || |       || || |  |      | |           ^*** || ||  || |||  |                | | |||||| || || | | |  ||| ||      || || |  ||  |  |   | | | |||    |   ||  | |   |  ||  |    | |||                || || || || |   | |  | |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   || ||  |  | ^** || ||             | |    |^** | || |       || || |  |      | |             |  || ||  || |||  |                | | |||||| || || | ^**  ||| ||      |^**| |  ||  |  |   | | ^**||    |   ||  | |   |  ||  |    | |||                || || || || |   | |  | |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   || ||  |  |  |  || ||             | |    |    | || |       || || |  |      | |             ^***| ||  || |||  |                | | |||||| || || | |    ||| ||      |^*** |  ||  ^***   | | |  ||    |   ||  | |   |  |^***    | |||                || || || || |   | ^*** |   |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   || ||  |  |  |  || ||             | |    |    | || |       || || |  |      | |                || ||  || |||  |                | | |||||| || || | |    ||| |*******^  |  |  ||  |      | | |  ||    |   ||  | |   |  |        | |||                || || || || |   |      |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   || ||  |  |  |  || ||             | |    |    | || |       || || |  |      | |                || ||  ^*****  |                | | |||||| || || | |    ||| |          |  |  ||  |      | | |  ||    ^*****  | |   |  |        | |||                || || || || |   |      |   |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..   || ||  |  |  |  || ***********************    | || |       || || |  |      | |                || ||  || ||   |                | | |||||| || || | |    ||| |          |  |  ||  |      | | |  ||        |   | |   |  |        | |||                || || || || |   |      |   |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_TYR ..   || ||  |  |  |  || ||             | |         | || |       || || |  |      | |                || ||  || ||   |                | ****^********| | |    ||| |          |  |  ||  |      | | |  ||        |   | |   |  |        | |||                || || || || |   |      |   |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *****  |  |  |  || ||             | |         | || |       ***** |  |      | |                || ||  || ||   |                | | |||||| ||  | | |    ||| |          |  |  ||  |      | | *****        |   | |   |  |        | |||                || || || || |   |      |   |
search RasMol script viewer Motif-ligand binding stats  betabulge ..   || ||  |  |  |  ** **             | |         | || |       || || |  |      | |                || ||  || ||   |                | | |||||| ||  | | |    ||| |          |  |  ||  |      | | |  |         |   | |   |  |        | |||                || || || || |   |      |   |
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****|  |  |  |                    | |         | || |       ****| ****      | |                *****  ****|   |                | | ||||****|  | | |    ||| |          |  |  ||  |      | | ****         |   | |   ****        ****|                ****| ****| |   |      |   |
search RasMol script viewer Motif-ligand binding stats  nest ..    |  |  |  |  |                    | |         ***| |        |  | |  |      | |                 |  |  || ||   |                *** **** |  |  | ***    *** |          |  |  ||  |      ***              |   ***   |  |          ***                 |  |  |  | |   |      |   |
search RasMol script viewer Motif-ligand binding stats  niche ..    *******  ****                    ***            | |        **** ****      ***                 ****  ****|   |                      |  ****  | |       ****          ****  |****                       |   |     ****                              ****  **** |   |      |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                    | |                                              *****  *****                      |        | |                           |   |                       |   |                                                  *****      |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                    | |                                                                                |        | |                           *****                       *****                                                             *****
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                    ***                                                                                |        ***                                                                                                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                       *                                                                                                                                         

   New search    2ofu:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML