triangle PDBeMotif: 2jcw  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.15.1.1
Classification oxidoreductase    | release date: Mon, Dec 21, 1998
Title reduced bridge-broken yeast cu/zn superoxide dismutase room temperature (298k) structure
Authors A.M.NERSISSIAN, D.EISENBERG, J.S.VALENTINE, M.M.BALBIRNIE, M.S.WEISS, N.L.OGIHARA, P.J.HART
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search CU1 CU1 binding statistics CU1
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRH
VGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CU/ZN SUPEROXIDE DISMUTASE
member of: CATH:search2.60.40.200GENE3D:searchG3DSA_2.60.40.200PANTHER:searchPTHR10003PFAM:searchPF00080PRINTS:searchCUZNDISMTASEPROSITE PATTERNS:searchPS00087/searchPS00332, SUPERFAMILY:searchSSF49329UniProt:searchP00445
JMol viewer RasMol script viewer  ZN 155A  ..                                                              *       *        *  *                                                                      
JMol viewer RasMol script viewer  CU1 154A  ..                                             * *              |       |        |  |                                    *                                 
sec str:  ...eeeeee......eeeeeee.......eeeeeeee......eeeeeee.........hhh.........................eee......eeeeeee..............eeee.............hhh.........eeee.eee.
sequence :  ..VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | |         |  |       | ||   |  | | |   | ||| |  | |   | |   |  | | |  | |    | |||   ^**|  |   |  | |          |||| |   |^**||| | |  |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | |         ^***       | ||   |  | | |   | ||| |  | |   | |   |  | | |  | |    | |||   ^***  |   |  | |          |||| |   |  |||| | |  |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | |         |  |       | ^*****  | | |   | ||^***** |   | |   |  | | |  | ^***** |^*****  |  |   |  | |          |||| |   |  |||| | |  |  |    
search RasMol script viewer Motif-ligand binding stats  SOD_CU_ZN_1 ..          | |         |  |       |  |      **^*^******|  |    |   | |   |  | | |  |      | |||      |  |   |  | |          |||| |   |  |||| | |  |  |    
search RasMol script viewer Motif-ligand binding stats  SOD_CU_ZN_2 ..          | |         |  |       |  |              | ||  |    |   | |   |  | | |  |      | |||      |  |   |  | |          |||| |   |  ||********^***    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |         |  |       |  |              | ||  |    |   | |   |  | | |  |      | |||      |  |   |  | |          |||| |   ***** | | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | |         |  |       |  |              ***|  |    |   | |   |  | | |  |      | |||      |  |   |  | |          **** |   |  || | | |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          | |         |  |       |  |                 |  |    |   | |   |  | | |  |      *****      |  |   |  | |           | | |   |  || | | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | |         |  |       |  |                 ****    |   | |   **** | |  |      ****|      |  |   |  | |           | | |   ****| | | |          
search RasMol script viewer Motif-ligand binding stats  nest ..          ***         |  |       |  |                         |   ***   |  | | |  |        ***      |  |   |  | |           *****       ***** |          
search RasMol script viewer Motif-ligand binding stats  niche ..                      ****       ****                         |         ****** ****                 ****   ******             ***             |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                              |                                               ***                             |          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                              *                                                                               *          

   New search    2jcw:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors