triangle PDBeMotif: 2j6f  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   6.3.2.
Classification protein binding    | release date: Thu, Sep 28, 2006
Title n-terminal sh3 domain of cms (cd2ap human homolog) bound to cbl-b peptide
Authors G.MONCALIAN, I.DIKI, M.SPINOLA-AMILIBIA, N.CARDENES, Y.L.DERIBE
Method X-RAY DIFFRACTION (resolution: 1.70Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETE
Chain C sequence:
PARPPKPRPRR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CD2-ASSOCIATED PROTEIN
member of: CATH:search2.30.30.40GENE3D:searchG3DSA_2.30.30.40PANTHER:searchPTHR14167/searchPTHR14167_SF7PFAM:searchPF14604PRINTS:searchSH3DOMAINPROSITE PROFILES:searchPS50002, SMART:searchSM00326SUPERFAMILY:searchSSF50044UniProt:searchQ9Y5K6
sec str:  ....eee..................eeeeeee.....eeeeee..eeeeeehhheee...
sequence :  ..VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKR
seq num:  ..2         12        22        32        42        52      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..            |  | | |  |       | |  |     |  |    |  |   **
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            |  | ^**  |       | |  |     |  |    |  |     
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..            |  |   |  |       | |  |     ^***    |  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  |   ****       | ****             |  |     
search RasMol script viewer Motif-ligand binding stats  niche ..            ****   ****       ******             ****     

chain C : E3 UBIQUITIN-PROTEIN LIGASE CBL-B
member of: PANTHER:searchPTHR23007/searchPTHR23007_SF3UniProt:searchQ13191
sec str:  ..........
sequence :  ..PPKPRPRR
seq num:  ..905     

   New search    2j6f:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors